KEGG   Herbaspirillum seropedicae: Hsero_2922Help
Entry
Hsero_2922        CDS       T01268                                 

Gene name
hemX
Definition
uroporphyrin-III C-methyltransferase (EC:2.1.1.107)
Orthology
K02496  
uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
hse  Herbaspirillum seropedicae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hsero_2922 (hemX)
Enzymes [BR:hse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Hsero_2922 (hemX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3319456..3320661)
Genome map
AA seq 401 aa AA seqDB search
MTEQQSTPQLPEPQPQASQTAGAAASQASYTFTAPDGTAALRRRQRAQTVLLLLVIAGLG
AQWWVSHAELRDLRSEVAQRLQSGDNSNNELKGVLKAVQESTKELQSRVSVLDSKQAESQ
SQQLALEQMYQDLNKNRDDWALSEIEEVLSTADQQLELAGNVQGALIALQNADKSLSRSD
KPQFIAIRRALARDIDRLKALPTVDIPGIAVRLDSAIGQIDNMPLLVDEKPVESASEPKP
QRVSPAVAGKASAAPAKSKAAAAVPEEAPASAWSQWLAGARETWQSMSTEMWAELRQLVR
IREVQTPEAILLSPGQAYFVRENLKLRLLNARLALLSRNEFAFRNDLASAQDTIAKYFDT
RAKQVQTTQALLKQVQGSNLAIQLPTLAESLNAVRNYKARH
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacagcaatccaccccccaattgccggagccccagccgcaagccagccagact
gctggcgcggccgcctcgcaggcctcctacaccttcaccgcgccggacggcacggctgcg
ctgcgccgtcgccagcgcgcccagaccgtcctgctgctgctggtcatcgccggcctgggc
gcacagtggtgggtttcccacgccgaactgcgcgacctgcgcagcgaagtggcgcagcgc
ctgcagagcggcgacaacagcaacaatgaattgaagggcgtgttgaaggccgtgcaggaa
agcaccaaggaactgcaatcgcgggtcagcgtgctcgacagcaagcaggccgaatcccag
agccagcagctggcgctggaacagatgtaccaggacctgaacaagaaccgcgacgactgg
gccctctccgagatcgaggaagtgctctccacggctgaccagcagctggaactggccggc
aacgtacagggcgcgctgatcgccctgcaaaacgccgacaagagcctgtcgcgctcggac
aagccgcaattcatcgccatccgccgcgccctggcgcgcgatatcgaccgcctcaaggca
ctgcccacggtcgacatccccggcatcgccgtacgcctggacagcgccatcggccagatc
gacaacatgcccctgctggtcgatgaaaagccagtggaatcggccagcgaacccaagccg
cagcgcgtgagcccggcggtagccggcaaggccagcgccgcccccgccaagagcaaggcg
gccgccgccgtcccggaggaggccccggcctcggcctggtcgcaatggctggccggcgcg
cgcgagacctggcagagcatgagcaccgaaatgtgggccgaattgcgccagctggtgcgc
atccgtgaagtgcagacgcccgaagccatcctgctctcgccggggcaggcctacttcgtc
cgcgaaaacctcaagctgcgcctgttgaatgcgcgtctggcgctgctttcgcgcaatgag
ttcgccttccgcaacgacctcgcctcggcccaggacaccatcgccaagtatttcgatacc
cgcgccaagcaggtgcagaccacccaggcgctgttgaagcaggtgcagggcagcaacctg
gccatccagctgccgaccctggccgagagcctcaacgccgtgcgcaactacaaggcccgc
cactga

DBGET integrated database retrieval system