KEGG   Herbaspirillum seropedicae: Hsero_2961Help
Entry
Hsero_2961        CDS       T01268                                 

Gene name
pcm
Definition
protein-L-isoaspartate carboxylmethyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hse  Herbaspirillum seropedicae
Brite
Enzymes [BR:hse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Hsero_2961 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3369349..3370314)
Genome map
AA seq 321 aa AA seqDB search
MSDKTSRFPLSLSSVVDKKKAAGVGRDAAGRPQATTQTAAKNAAQSSQRAALKPVQQGLA
QALRPPPAPPRAPVPPAQPLLSAAPVPRTAVSNVMTVTQTNASHHASPLASEAVRKAMVA
RVAKQGVADAKVLAALEAVPRHMFVEPGLASQAYIDASLPIGHHQTISQPYIVARMIEIM
RQNRHGGRLDRVLEIGTGCGYQAAVLSRVAGEVYSIERIKPLHELAKTNLRPLRVANIRL
HYGDGMLGLPQVAPFDGIILAAAGLEVPQALLEQLAVGGRLVAPVGERQQVLELIERVGP
RDWRRTTLEQCHFVPLRPGTV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaagaccagccgctttccgctctcgctgtcctcggtggtggacaagaagaag
gctgcaggagtcgggcgggacgcggctggccgcccccaggcgaccacccagacggccgcc
aagaatgccgcccagtcgtcccagcgcgctgcgctcaagccggtgcagcaggggctggcg
caggcattgcgcccgcctccggcgccaccgcgcgcgcccgtgccgccagcccagcccctg
ctgagcgccgcgccggtgccgcgcactgcggtcagcaatgtcatgacggtgacccagacc
aacgcttcccatcacgcctcgccgctggcttccgaagccgtgcgcaaggccatggtggcg
cgcgtggccaagcagggggtagctgacgccaaggtgctggcggcgctggaggcggtgccg
cgccacatgttcgtggagccgggtctggccagtcaggcctatatcgatgcttccttgccc
atcggccatcaccagaccatttcccaaccctatatcgtggcgcggatgatcgagatcatg
cgccagaaccgccatggcggccggctggaccgggtgctggagatcgggaccggctgcggt
tatcaggcggccgtgctgtcccgggtggcgggtgaggtgtattccatcgagcgcatcaag
cctctgcacgaactggccaagaccaatctgcgtccattgcgggtggcaaacatccgcttg
cattacggagatggtatgcttggcctgccgcaggtggcgccttttgacggcatcatcctg
gcagctgccgggctggaggtgccgcaggccttgctggagcagttggccgtcggtggccgc
ctggtcgcccccgtgggtgaacggcagcaggtactggagttgatagaacgggtaggaccg
cgcgactggcgccgcaccacgctggagcaatgccatttcgtgccgctgcgcccgggtacc
gtgtaa

DBGET integrated database retrieval system