KEGG   Herbaspirillum seropedicae: Hsero_2968Help
Entry
Hsero_2968        CDS       T01268                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex protein (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hse  Herbaspirillum seropedicae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hsero_2968 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hsero_2968 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Hsero_2968 (sucB)
Enzymes [BR:hse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Hsero_2968 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3378451..3379692)
Genome map
AA seq 413 aa AA seqDB search
MAQIEVKVPQLSESVAEATLLQWHKKVGEPVSRDENLIDIETDKVVLELPSPDAGVITQI
IKADGATVVAGEVIAILDTDASAQVAPTEVKAAPAPQATNEPTPVAAPELASKGDVAMPA
AAKLLADNNLSTSQVTGTGKDGRVTKGDVLGALSAPAAAPAAAAKPALAQVAAPVKAGLE
SRPEQRVPMSRLRARVAERLVQSQSTNAILTTFNEINMQPVIDLRNKYKDKFEKEHGVKL
GFMSFFVKAVVHALKKYPIVNASVDGNDIVYHGYFDIGVAVGSPRGLVVPILRDADQMSI
ADIEKKIGEFGQKAKDGKLSIEELSGGTFTVSNGGTFGSMLSTPIINPPQSAILGIHATK
ERAVVENGQVVVRPINYFALSYDHRIIDGREAVLSLVAIKEALEDPARLLLDL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaatcgaagtaaaagtcccgcagttgtcggaatccgtcgccgaagcgaccctg
ctgcaatggcacaagaaggttggcgaacccgtttcccgtgacgaaaacctgatcgacatc
gagaccgacaaggtcgtgctggaactgccctcgccggacgccggcgtgatcacccagatc
atcaaggccgacggcgcaaccgtcgtggccggtgaagtgatcgccatcctcgacaccgac
gcttccgcccaagtggccccgaccgaagtcaaggcggctcccgcaccgcaagcgaccaac
gaaccgaccccggtcgccgctcccgagctggcttccaagggcgacgtcgccatgccggcc
gccgccaagctgctggccgacaacaacctgtcgacctcgcaagtcaccggcaccggcaag
gatggccgcgtgaccaagggcgacgtgctgggcgcgctgtcggctcctgctgccgcacct
gccgccgctgccaagccggccctggcgcaagtcgccgccccggtcaaggccggtctggaa
agccgtccggaacagcgcgtgccgatgagccgcctgcgtgcccgcgtggccgagcgtctg
gtgcagtcgcaatcgaccaacgccatcctgaccaccttcaacgaaatcaacatgcagccg
gtcatcgacctgcgcaacaagtacaaggacaagttcgagaaggaacacggcgtcaagctg
ggcttcatgtccttcttcgtcaaggcggtcgtgcatgccctgaagaagtacccgatcgtc
aacgcctcggtcgatggcaacgacatcgtctaccacggctacttcgacatcggcgtggcc
gtcggttcgccgcgcggtctggtggtgcccatcctgcgtgatgcggaccagatgtcgatt
gccgacatcgagaagaagatcggtgaattcggccagaaggccaaggacggcaagctgtcc
atcgaagaactgtcgggcggtaccttcaccgtctccaacggcggtaccttcggttccatg
ctgtcgaccccgatcatcaacccgccgcaatcggcgatcctgggcatccacgccaccaag
gaacgcgctgtggttgaaaacggccaggtcgtggttcgtccgatcaactacttcgcgctg
tcctatgaccaccgcatcatcgacggccgcgaagccgtcctgtcgctggtcgcgatcaag
gaagccctggaagacccggcccgtctgctgctggatctgtaa

DBGET integrated database retrieval system