KEGG   Herbaspirillum seropedicae: Hsero_3291Help
Entry
Hsero_3291        CDS       T01268                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase (alpha chain) protein (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hse  Herbaspirillum seropedicae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hsero_3291 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hsero_3291 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hsero_3291 (trpA)
Enzymes [BR:hse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hsero_3291 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3769690..3770487)
Genome map
AA seq 265 aa AA seqDB search
MSRIQTTFSQLAEQKRKALITFITAGDPAPELTVPLLHALVAGGVDILELGVPFSDPMAE
GPVIQRACERALKFGISTHDVLGYVREFRKTNTHTPIVLMGYANPIERFGVDAFIAAASE
AGVDGTIVVDYPPEECEEFAQKMQAKGMDPIFLLAPTSSQERIRQVAAVSSGFCYYVSLK
GVTGAGHIDTAEVAERIAAIRQHVKLPIAVGFGIRDGATARTVGSVADAVVIGSRIIAEL
ENTPQDQACDAVQAFVTDIRQALDA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaatccagaccaccttttcccaactggccgagcaaaagcgcaaggccctgatc
actttcatcaccgccggcgacccggcccccgagctgaccgtgccgctgctgcacgcgctg
gtggccggtggcgtggatatcctcgagctgggcgtgccattctccgaccccatggccgaa
ggcccggtgatccagcgcgcttgcgagcgcgccctgaaattcggcatcagcacccatgac
gtgctgggctacgtgcgcgaattccgcaagaccaatacccacacccccatcgtgctgatg
ggctatgccaatccgatcgagcgctttggcgtggacgccttcatcgcggcggccagcgaa
gcgggcgtggatggcactatcgtggtggactatccgcccgaggaatgtgaagaattcgcc
cagaagatgcaggccaagggcatggacccgatcttcctgctggcgccgacctcctcgcaa
gagcgcatccgccaggtggcggccgtcagcagcggcttctgctactacgtctcgctcaag
ggcgtgaccggcgcgggtcacatcgatacggctgaagtggccgagcgcatcgccgccatc
cgccagcatgtgaagctgcccattgcggtgggctttggcatccgtgacggcgctaccgcc
cgtaccgtgggcagcgtggccgatgcggtcgtcatcggcagccgcatcatcgccgaactg
gaaaataccccgcaagaccaggcctgtgacgcggtgcaagccttcgtcaccgatatccgc
caggcgctggatgcctga

DBGET integrated database retrieval system