KEGG   Herbaspirillum seropedicae SmR1: Hsero_3291Help
Entry
Hsero_3291        CDS       T01268                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase (alpha chain) protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00260  Glycine, serine and threonine metabolism
hse00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
hse01130  Biosynthesis of antibiotics
hse01230  Biosynthesis of amino acids
Module
hse_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hsero_3291 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hsero_3291 (trpA)
Enzymes [BR:hse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hsero_3291 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Peripla_BP_6 His_biosynth PcrB PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADJ64772
UniProt: D8J1Y9
Position
complement(3769690..3770487)
Genome map
AA seq 265 aa AA seqDB search
MSRIQTTFSQLAEQKRKALITFITAGDPAPELTVPLLHALVAGGVDILELGVPFSDPMAE
GPVIQRACERALKFGISTHDVLGYVREFRKTNTHTPIVLMGYANPIERFGVDAFIAAASE
AGVDGTIVVDYPPEECEEFAQKMQAKGMDPIFLLAPTSSQERIRQVAAVSSGFCYYVSLK
GVTGAGHIDTAEVAERIAAIRQHVKLPIAVGFGIRDGATARTVGSVADAVVIGSRIIAEL
ENTPQDQACDAVQAFVTDIRQALDA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaatccagaccaccttttcccaactggccgagcaaaagcgcaaggccctgatc
actttcatcaccgccggcgacccggcccccgagctgaccgtgccgctgctgcacgcgctg
gtggccggtggcgtggatatcctcgagctgggcgtgccattctccgaccccatggccgaa
ggcccggtgatccagcgcgcttgcgagcgcgccctgaaattcggcatcagcacccatgac
gtgctgggctacgtgcgcgaattccgcaagaccaatacccacacccccatcgtgctgatg
ggctatgccaatccgatcgagcgctttggcgtggacgccttcatcgcggcggccagcgaa
gcgggcgtggatggcactatcgtggtggactatccgcccgaggaatgtgaagaattcgcc
cagaagatgcaggccaagggcatggacccgatcttcctgctggcgccgacctcctcgcaa
gagcgcatccgccaggtggcggccgtcagcagcggcttctgctactacgtctcgctcaag
ggcgtgaccggcgcgggtcacatcgatacggctgaagtggccgagcgcatcgccgccatc
cgccagcatgtgaagctgcccattgcggtgggctttggcatccgtgacggcgctaccgcc
cgtaccgtgggcagcgtggccgatgcggtcgtcatcggcagccgcatcatcgccgaactg
gaaaataccccgcaagaccaggcctgtgacgcggtgcaagccttcgtcaccgatatccgc
caggcgctggatgcctga

DBGET integrated database retrieval system