KEGG   Herbaspirillum seropedicae: Hsero_3292Help
Entry
Hsero_3292        CDS       T01268                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase (beta chain) protein (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hse  Herbaspirillum seropedicae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hsero_3292 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hsero_3292 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hsero_3292 (trpB)
Enzymes [BR:hse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hsero_3292 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3770564..3771823)
Genome map
AA seq 419 aa AA seqDB search
MKELNPLGGFAERQAIPAAALHQTAHYNLPDSRGHFGPYGGSFVSETLTLALNELREAYA
RYQHDEQFLAEFHTELKHFVGRPSPVYHAKRWSEMAGGAQIYFKREDLNHTGAHKINNVI
GQALLAKRMGKKRIIAETGAGQHGVATATICARFGMECIVYMGSEDVKRQLQNVYRMNLL
GAKVVPVESGSKTLKDALNEAMRDWVTNVETTFYIIGTVAGPHPYPMMVRDFQSVIGNEC
IQQMPEIASRQPDYVVAAVGGGSNAMGIFYPYIDYPDVKLVGVEAAGDGLDTGRHSASLT
LGSPGVLHGNRTYLLQDANGQIIETHSVSAGLDYPGVGPEHAWLKDSGRASYACITDDEA
LEAFNTCCRIEGIIPALESSHALAHAAKLAATLPRDQIVLVNLSGRGDKDMHTVQQRQG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattgaatcccctcggcggtttcgccgagcgtcaagccattcctgccgccgcc
ctgcaccagacggcccactacaacctgcccgattcccgcggccatttcggcccgtacggc
ggcagcttcgtgtccgaaacgctgaccctggccttgaacgagctgcgcgaggcctatgcg
cgttaccagcacgatgagcagttcctggccgaattccataccgaactgaagcatttcgtc
ggtcgtcccagcccggtgtaccacgccaagcgctggtccgagatggcgggtggcgcgcag
atctacttcaagcgcgaagacctgaaccacaccggcgcccacaagatcaacaacgtgatc
ggccaggcgctcttggccaagcgcatgggcaagaagcgcatcatcgccgagaccggcgcc
ggccagcacggcgtggccacggccaccatctgcgcgcgcttcggcatggaatgcatcgtc
tacatgggcagtgaagacgtgaagcgccaattgcagaacgtctaccgcatgaacctcttg
ggcgccaaggtggtgccggtggagtccggttccaagaccctgaaggatgcgctcaatgaa
gccatgcgcgactgggtcaccaatgtcgagaccaccttctacatcatcggcaccgtggcc
ggtccgcacccctatccgatgatggtgcgcgacttccagtcagtgatcggcaacgagtgc
atccagcagatgccggaaatcgcctcgcgccagcccgactacgtggtggcggcggtgggt
ggtggttccaacgccatgggcatcttctatccctacatcgactacccggacgtcaagctg
gtcggcgtggaagccgccggcgatggcctggacactggccgtcactcggcctcgctgacc
ctgggctcgcccggcgtgctgcacggcaaccgtacctacctgctgcaggacgccaacggc
cagatcatcgagacccactcggtctcggccggcctggactatccgggcgtgggcccggaa
cacgcctggctcaaggacagcggtcgcgccagctatgcctgcatcaccgatgacgaggcg
ctcgaagccttcaatacctgctgccgcatcgaaggcatcatccccgcgctggagtccagc
cacgcactggcccatgcggccaagctggcggccaccttgccgcgggaccagatcgtgctg
gtcaacctgtccggccggggggacaaggacatgcataccgtgcaacagcgccagggttga

DBGET integrated database retrieval system