KEGG   Herbaspirillum seropedicae SmR1: Hsero_3580Help
Entry
Hsero_3580        CDS       T01268                                 

Gene name
glk
Definition
(GenBank) glucokinase protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00010  Glycolysis / Gluconeogenesis
hse00052  Galactose metabolism
hse00500  Starch and sucrose metabolism
hse00520  Amino sugar and nucleotide sugar metabolism
hse00521  Streptomycin biosynthesis
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
hse01120  Microbial metabolism in diverse environments
hse01130  Biosynthesis of antibiotics
hse01200  Carbon metabolism
Module
hse_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hsero_3580 (glk)
   00052 Galactose metabolism
    Hsero_3580 (glk)
   00500 Starch and sucrose metabolism
    Hsero_3580 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Hsero_3580 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hsero_3580 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Hsero_3580 (glk)
Enzymes [BR:hse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Hsero_3580 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADJ65059
UniProt: D8IQE7
Position
4107766..4108767
Genome map
AA seq 333 aa AA seqDB search
MQHVPTSPAGLHADGPRLLADIGGTNARFALETGPGRIEQVQILRGADYGEFTDAVQAYL
KLAGHPPVRHAVVAIANPVQGDQIKMTNHDWAFSIEAARQLLGFELLLVVNDFTALSMAV
PQLRADELQQVGGGAPKPGAPIGLVGAGTGLGVGGLLHADGHWLPLASEGGHAAFAPADP
REAAVLAYAWQFHEHVSAERLVSGPGLELIHRALLAIDGHPAAELSAAQIVEGARQHGDA
LCQETLALFCSMLGTVAADLALTLGALGGIYIGVGVVPHLGDYFARSPFRARFENKGRMS
VLTKAIPTYVITAEYPAFTGVSAILADRLATQQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacgttcccacctcccctgccggactgcacgctgacggtccgcgcctgctggcc
gacatcggcggcaccaatgcccgctttgcactggaaaccggccccggccgcatcgagcag
gtacagatcctgcgcggcgctgactatggcgaattcaccgatgcggtccaggcctacctc
aagctggcaggccacccgccggtgcgccatgcggtggtggccatcgccaacccggtgcag
ggcgaccagatcaagatgaccaaccacgattgggccttctccatcgaagcggcgcgccaa
ttgctgggattcgaattgctgctggtggtcaatgatttcacggccctgtcgatggccgtg
ccgcaactgcgcgccgatgagctgcaacaggtcggcggcggcgcacccaagccgggagca
ccgatcgggctggtgggcgccggcaccggactgggcgtgggcggactgctgcatgccgac
ggtcactggctgccgctggccagcgagggtggccatgcggcctttgccccggcggatccg
cgtgaggccgccgtgctggcctatgcctggcaattccatgagcatgtgtcggccgaacgg
ctggtctcgggtccgggactggagctgatccatcgcgccttgctggccatcgatggccat
cccgctgccgagctgagcgcagcgcagatcgtggaaggcgcacgccagcatggcgatgcg
ctttgccaggaaacgctggcgctgttctgcagcatgctcggcaccgtggcggccgacctg
gcgctcacgctgggcgcgctgggcggcatctacatcggcgtgggcgtagtgccgcacctg
ggcgactacttcgcccgttcgcccttccgggcgcgcttcgagaacaagggacgcatgtcc
gtgctcaccaaggccattcccacctatgtgatcacggcggagtatccggccttcaccggg
gtctcggccatcctggcggaccgcctggcgacacagcagtaa

DBGET integrated database retrieval system