KEGG   Herbaspirillum seropedicae: Hsero_3580Help
Entry
Hsero_3580        CDS       T01268                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hse  Herbaspirillum seropedicae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hsero_3580 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hsero_3580 (glk)
   00052 Galactose metabolism
    Hsero_3580 (glk)
   00500 Starch and sucrose metabolism
    Hsero_3580 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Hsero_3580 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hsero_3580 (glk)
   00524 Butirosin and neomycin biosynthesis
    Hsero_3580 (glk)
Enzymes [BR:hse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Hsero_3580 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4107766..4108767
Genome map
AA seq 333 aa AA seqDB search
MQHVPTSPAGLHADGPRLLADIGGTNARFALETGPGRIEQVQILRGADYGEFTDAVQAYL
KLAGHPPVRHAVVAIANPVQGDQIKMTNHDWAFSIEAARQLLGFELLLVVNDFTALSMAV
PQLRADELQQVGGGAPKPGAPIGLVGAGTGLGVGGLLHADGHWLPLASEGGHAAFAPADP
REAAVLAYAWQFHEHVSAERLVSGPGLELIHRALLAIDGHPAAELSAAQIVEGARQHGDA
LCQETLALFCSMLGTVAADLALTLGALGGIYIGVGVVPHLGDYFARSPFRARFENKGRMS
VLTKAIPTYVITAEYPAFTGVSAILADRLATQQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacgttcccacctcccctgccggactgcacgctgacggtccgcgcctgctggcc
gacatcggcggcaccaatgcccgctttgcactggaaaccggccccggccgcatcgagcag
gtacagatcctgcgcggcgctgactatggcgaattcaccgatgcggtccaggcctacctc
aagctggcaggccacccgccggtgcgccatgcggtggtggccatcgccaacccggtgcag
ggcgaccagatcaagatgaccaaccacgattgggccttctccatcgaagcggcgcgccaa
ttgctgggattcgaattgctgctggtggtcaatgatttcacggccctgtcgatggccgtg
ccgcaactgcgcgccgatgagctgcaacaggtcggcggcggcgcacccaagccgggagca
ccgatcgggctggtgggcgccggcaccggactgggcgtgggcggactgctgcatgccgac
ggtcactggctgccgctggccagcgagggtggccatgcggcctttgccccggcggatccg
cgtgaggccgccgtgctggcctatgcctggcaattccatgagcatgtgtcggccgaacgg
ctggtctcgggtccgggactggagctgatccatcgcgccttgctggccatcgatggccat
cccgctgccgagctgagcgcagcgcagatcgtggaaggcgcacgccagcatggcgatgcg
ctttgccaggaaacgctggcgctgttctgcagcatgctcggcaccgtggcggccgacctg
gcgctcacgctgggcgcgctgggcggcatctacatcggcgtgggcgtagtgccgcacctg
ggcgactacttcgcccgttcgcccttccgggcgcgcttcgagaacaagggacgcatgtcc
gtgctcaccaaggccattcccacctatgtgatcacggcggagtatccggccttcaccggg
gtctcggccatcctggcggaccgcctggcgacacagcagtaa

DBGET integrated database retrieval system