KEGG   Herbaspirillum seropedicae: Hsero_3805Help
Entry
Hsero_3805        CDS       T01268                                 

Gene name
btuE
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
hse  Herbaspirillum seropedicae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Hsero_3805 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Hsero_3805 (btuE)
Enzymes [BR:hse01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Hsero_3805 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4358014..4358499
Genome map
AA seq 161 aa AA seqDB search
MTTIYDFQPRLANEQALPLEQLRGKVLLIVNTASKCGFTPQYNGLEAIHRQFHARGLEVL
AFPCNQFGGQEPGNAEEIGAFCEKNYGVSFPLFAKIDVNGDQADPLFQYLKKEAPGLLGS
KAIKWNFTKFLVGRDGKVFKRYAPQTRPEEIVADIEALLAA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatctatgatttccagccccgcctggccaatgaacaagcgctgccgctggaa
cagttgcgcggcaaggtgctgctcatcgtcaataccgccagcaagtgcggtttcaccccg
caatacaacgggctggaagccatccatcgccagttccatgcacgcggactggaagtgctg
gccttcccctgcaaccagttcggcgggcaggaacccggcaatgccgaggagatcggcgca
ttctgcgaaaagaactacggcgtgagcttcccgctgtttgccaagatcgatgtcaatggc
gaccaggccgatcccctgttccagtacctgaagaaggaagccccgggcctgctgggcagc
aaggccatcaagtggaatttcaccaagttcctggtgggccgggacggcaaggtcttcaag
cgctatgcgccgcagacccgtccggaagaaatcgtcgccgacatcgaggcgctgctggcc
gcataa

DBGET integrated database retrieval system