KEGG   Herbaspirillum seropedicae SmR1: Hsero_3886Help
Entry
Hsero_3886        CDS       T01268                                 

Gene name
paaF
Definition
(GenBank) enoyl-CoA hydratase protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00071  Fatty acid degradation
hse00280  Valine, leucine and isoleucine degradation
hse00281  Geraniol degradation
hse00310  Lysine degradation
hse00360  Phenylalanine metabolism
hse00362  Benzoate degradation
hse00380  Tryptophan metabolism
hse00410  beta-Alanine metabolism
hse00627  Aminobenzoate degradation
hse00640  Propanoate metabolism
hse00650  Butanoate metabolism
hse00903  Limonene and pinene degradation
hse00930  Caprolactam degradation
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
hse01120  Microbial metabolism in diverse environments
hse01130  Biosynthesis of antibiotics
hse01212  Fatty acid metabolism
Module
hse_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Hsero_3886 (paaF)
   00650 Butanoate metabolism
    Hsero_3886 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    Hsero_3886 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hsero_3886 (paaF)
   00310 Lysine degradation
    Hsero_3886 (paaF)
   00360 Phenylalanine metabolism
    Hsero_3886 (paaF)
   00380 Tryptophan metabolism
    Hsero_3886 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Hsero_3886 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Hsero_3886 (paaF)
   00281 Geraniol degradation
    Hsero_3886 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Hsero_3886 (paaF)
   00627 Aminobenzoate degradation
    Hsero_3886 (paaF)
   00930 Caprolactam degradation
    Hsero_3886 (paaF)
Enzymes [BR:hse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Hsero_3886 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 HA2 CnrY
Motif
Other DBs
NCBI-ProteinID: ADJ65359
UniProt: D8IS16
Position
complement(4448791..4449567)
Genome map
AA seq 258 aa AA seqDB search
MSYENIQVETHEKVGLIRLHRPKALNALSDGLMTELGEALLAFDAQEEIGCIIITGSEKA
FAAGADISAMAGYDYMDVFKGEFITRNWETLRRIRKPVIAAVAGYALGGGCELAMMCDFI
IAADNAKFGQPEIKLGIVPGAGGTQRLPRAVSKAKAMDLALTGRMMDAEEAERAGLVSRI
VAADKLLEEAMAAAIIIAEMPRQVAMMVKDSVNRAYETTLSEGMKYERALFYSCFATEDQ
KEGMKAFLEKRQPVFKHS
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgaaaatatccaggtcgaaacccacgagaaggtcggtctgatccgcctgcac
cgtcccaaggccctcaatgccctcagcgacggcctcatgaccgagctgggcgaggccctg
ctggccttcgatgcgcaggaggagatcggctgcatcatcatcacgggcagcgaaaaggcc
ttcgccgcaggcgccgatatcagcgccatggccggctatgactatatggatgtcttcaag
ggcgagttcattacccgcaactgggaaaccctgcgccgcatccgcaagccggtgattgcg
gcggtggccggctacgcgctgggcggcggctgtgagctggcgatgatgtgtgacttcatc
attgccgccgacaacgccaagttcggccagccagagatcaagctgggcatcgtgcccggc
gccggcggcacccagcgcctgccgcgcgcagtgtccaaggccaaggccatggacctggct
ctgaccgggcgcatgatggatgccgaggaggccgagcgcgccgggctggtctcgcgcatc
gtggccgcggacaagctgctggaggaagccatggctgcagcgatcatcattgccgagatg
ccgcgccaggtggccatgatggtgaaggactcggtcaatcgcgcctatgaaaccacgctc
tcggaggggatgaagtatgagcgggcgctcttctatagctgctttgctaccgaagaccag
aaggaggggatgaaggccttcctggaaaaacgccagccagtattcaagcattcctga

DBGET integrated database retrieval system