KEGG   Herbaspirillum seropedicae: Hsero_3886Help
Entry
Hsero_3886        CDS       T01268                                 

Gene name
paaF
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
hse  Herbaspirillum seropedicae
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Hsero_3886 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Hsero_3886 (paaF)
   00650 Butanoate metabolism
    Hsero_3886 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    Hsero_3886 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hsero_3886 (paaF)
   00310 Lysine degradation
    Hsero_3886 (paaF)
   00360 Phenylalanine metabolism
    Hsero_3886 (paaF)
   00380 Tryptophan metabolism
    Hsero_3886 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Hsero_3886 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Hsero_3886 (paaF)
   00281 Geraniol degradation
    Hsero_3886 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Hsero_3886 (paaF)
   00627 Aminobenzoate degradation
    Hsero_3886 (paaF)
   00930 Caprolactam degradation
    Hsero_3886 (paaF)
Enzymes [BR:hse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Hsero_3886 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4448791..4449567)
Genome map
AA seq 258 aa AA seqDB search
MSYENIQVETHEKVGLIRLHRPKALNALSDGLMTELGEALLAFDAQEEIGCIIITGSEKA
FAAGADISAMAGYDYMDVFKGEFITRNWETLRRIRKPVIAAVAGYALGGGCELAMMCDFI
IAADNAKFGQPEIKLGIVPGAGGTQRLPRAVSKAKAMDLALTGRMMDAEEAERAGLVSRI
VAADKLLEEAMAAAIIIAEMPRQVAMMVKDSVNRAYETTLSEGMKYERALFYSCFATEDQ
KEGMKAFLEKRQPVFKHS
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgaaaatatccaggtcgaaacccacgagaaggtcggtctgatccgcctgcac
cgtcccaaggccctcaatgccctcagcgacggcctcatgaccgagctgggcgaggccctg
ctggccttcgatgcgcaggaggagatcggctgcatcatcatcacgggcagcgaaaaggcc
ttcgccgcaggcgccgatatcagcgccatggccggctatgactatatggatgtcttcaag
ggcgagttcattacccgcaactgggaaaccctgcgccgcatccgcaagccggtgattgcg
gcggtggccggctacgcgctgggcggcggctgtgagctggcgatgatgtgtgacttcatc
attgccgccgacaacgccaagttcggccagccagagatcaagctgggcatcgtgcccggc
gccggcggcacccagcgcctgccgcgcgcagtgtccaaggccaaggccatggacctggct
ctgaccgggcgcatgatggatgccgaggaggccgagcgcgccgggctggtctcgcgcatc
gtggccgcggacaagctgctggaggaagccatggctgcagcgatcatcattgccgagatg
ccgcgccaggtggccatgatggtgaaggactcggtcaatcgcgcctatgaaaccacgctc
tcggaggggatgaagtatgagcgggcgctcttctatagctgctttgctaccgaagaccag
aaggaggggatgaaggccttcctggaaaaacgccagccagtattcaagcattcctga

DBGET integrated database retrieval system