KEGG   Herbaspirillum seropedicae SmR1: Hsero_4136Help
Entry
Hsero_4136        CDS       T01268                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00071  Fatty acid degradation
hse00280  Valine, leucine and isoleucine degradation
hse00281  Geraniol degradation
hse00310  Lysine degradation
hse00360  Phenylalanine metabolism
hse00362  Benzoate degradation
hse00380  Tryptophan metabolism
hse00410  beta-Alanine metabolism
hse00627  Aminobenzoate degradation
hse00640  Propanoate metabolism
hse00650  Butanoate metabolism
hse00903  Limonene and pinene degradation
hse00930  Caprolactam degradation
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
hse01120  Microbial metabolism in diverse environments
hse01130  Biosynthesis of antibiotics
hse01212  Fatty acid metabolism
Module
hse_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Hsero_4136
   00650 Butanoate metabolism
    Hsero_4136
  Lipid metabolism
   00071 Fatty acid degradation
    Hsero_4136
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hsero_4136
   00310 Lysine degradation
    Hsero_4136
   00360 Phenylalanine metabolism
    Hsero_4136
   00380 Tryptophan metabolism
    Hsero_4136
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Hsero_4136
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Hsero_4136
   00281 Geraniol degradation
    Hsero_4136
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Hsero_4136
   00627 Aminobenzoate degradation
    Hsero_4136
   00930 Caprolactam degradation
    Hsero_4136
Enzymes [BR:hse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Hsero_4136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADJ65606
UniProt: D8ITH6
Position
4738225..4739013
Genome map
AA seq 262 aa AA seqDB search
MQDTVAYEDLLAARHGEHVLHLTLNRPALRNALRNQSLREIVAALARAEEDDSVRVVVIS
GNEKAFAAGADLNEMIHKDAIATQLDVRAQYWRAIARFPKPILAAVNGYALGAGCELLMH
ADIAIAARGAKIGQPEINVGTLPGAGGTQRLIRTVGKPLAMKMVLSGEFISADQALQAGL
VAEVVDDDATLERTLALAHSIAQKSPLAVRLAKEAMLQSFELGLEAGLLFERKSFSLMAA
SADRQEGIAAFQEKRAAVFSGR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacaccgtggcttacgaagacctgctggcggcgcggcatggcgagcatgtgctg
catctgaccctgaaccgtccagcgctgcgcaatgccttgcgcaaccagagcctgcgcgag
atcgtcgccgcgctagcgcgcgcagaggaagatgacagcgtgcgcgtggtcgtcatcagc
ggcaacgagaaagcctttgccgccggggccgatctcaacgagatgatccacaaggacgcc
atcgccacccagctcgatgtgcgtgcgcagtactggcgcgccattgcccgcttccccaaa
cccatcctggcggcggtgaatggctatgcgctgggcgcgggctgcgagttgctcatgcat
gccgacatcgccattgccgctcgcggggccaagatcggccagccggaaatcaatgtgggc
accctccccggcgccggtggcacccagcgcctcatccgcacggtgggcaagccgctggcg
atgaagatggtgctctccggcgaattcatcagtgccgaccaggccctgcaggccggcctg
gtggccgaggtggtggacgatgacgctaccctggaacgcacactggcgctggcccacagc
atcgctcagaaatcaccgctggcggtgcgtctggccaaggaagccatgctgcaatccttc
gagctggggctggaagcgggcctgctgttcgaacgcaaatccttttccctgatggcggca
agcgccgatcgccaggagggcatcgcggccttccaggaaaaacgcgccgcggtcttcagc
ggccgctga

DBGET integrated database retrieval system