KEGG   Herbaspirillum seropedicae SmR1: Hsero_4189Help
Entry
Hsero_4189        CDS       T01268                                 

Gene name
dsbC
Definition
(GenBank) thiol:disulfide interchange protein
  KO
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hse  Herbaspirillum seropedicae SmR1
Brite
Enzymes [BR:hse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Hsero_4189 (dsbC)
Chaperones and folding catalysts [BR:hse03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Hsero_4189 (dsbC)
Secretion system [BR:hse02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Hsero_4189 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4795275..4796042)
Genome map
AA seq 255 aa AA seqDB search
MKNFLTAGASSLRHLSMAALLLASTVVGVSAHAQAEAAESTEATIKKLIEPRLGKDAKVD
AVTKTPYAGLYEIQIDGDVIYTDAKAQYLFIGRVVDSQTYRDYTKEKIESLNQIPFSGLP
LDKAIKTVKGNGKRVIAIFEDPNCIYCKRLHKTLQEVDNITYYTFQYNILSPDSIVKSRN
IWCAPNPSRAWSEWMVNGKEAPAAATSCNAPHEDVLALGQKLKVTGTPTIFFTDGSRIPG
AVDAKSLEQKLSSLK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattttttgaccgcaggtgcgagctccttgcgccatctgagcatggcagcattg
ctgctggcctccaccgtcgtgggcgtgagcgcccatgcgcaagccgaggccgctgagagc
accgaggccaccatcaagaagctgatcgagccgcgcctgggcaaggatgccaaggtcgac
gccgtcaccaagacgccctatgccggcctctatgaaatccagatcgatggcgacgtcatc
tataccgatgccaaggcccagtatctcttcatcggccgcgtggtcgattcgcagacctac
cgcgactacaccaaggaaaagatcgagtcgctgaaccagatcccgttctcggggctgccg
ctggacaaggccatcaagaccgtcaagggcaatggcaagcgggtgatcgccatcttcgag
gatcccaactgcatctattgcaagcgcctccacaagacgctgcaggaagtggacaacatc
acctattacaccttccagtacaacatcctctcgccggactccatcgtgaagtcgcgcaac
atctggtgcgcgcccaatccaagccgcgcgtggagcgagtggatggtcaacggcaaggaa
gcgccggctgccgccacctcctgcaatgcgccgcatgaagacgtgctggcgctgggccag
aagctcaaggtcactggcacgccgaccatcttcttcaccgatggctcgcgtatccccggg
gcggtcgacgccaagtcgctggaacagaagctgtcttcgctgaagtaa

DBGET integrated database retrieval system