KEGG   Herbaspirillum seropedicae: Hsero_4215Help
Entry
Hsero_4215        CDS       T01268                                 

Gene name
asnB
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hse  Herbaspirillum seropedicae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hse00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4820788..4822671
Genome map
AA seq 627 aa AA seqDB search
MCGIAGSFWKNSDLQSNIRMERALQIMRERGPNHQDYHRHDTAGGSALLGQTRLSVIDLS
EQASQPMYSPDGRYGLIFNGEIYNYIELREELARAGRNFHTQSDTEVLLAAWEAWGEAAL
RRLTGMFAFAVFDFQLRTCTLVRDAFGIKPLFYASTGEGFYFASDTRAMRALAPCSPALN
WQRAYDYLVHGEYDFGNETFFSEFSSLSPGHMIEVPLDQARTMLPRCWWKPSIIKDSTSS
FEEASMQLRELLLESVKLHLRSDVPLGAALSGGIDSSVIVCAMRQIEPDLPIHTFSFVAS
ESAVSEEHWVDLVNKHVGAIAHKVHVTPEELAHDLESLIDTQGEPFGSTSIYAQYRVFKL
AQQNGVTVTLDGQGADEMMGGYNGYPGQRMLSLLDKGAYVQALTFLRNWAAWPGRSPIEG
LKRLVGAGSSGQFNSILRRLNGMQNIPDWIRPGPLREAGVRLSYPQAQPIAPDHGRRMMA
FLAQSLTERGLLGLLRHGDRNSMRFSVESRVPFLTTGLVEFMLRQPEEYLVSPSGETKAL
LRASMRGIVPDAVLDRRDKIGFATPEKAWMFSMADTVRQWLADDTGLPFLDQAAICEHFE
QILAGKRPYTWQVWRWINFIRWYKGLN
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatagctggcagtttctggaaaaactccgacctacagtccaacatcaggatg
gagcgcgccttgcagatcatgcgggagcgcggccccaatcatcaggattaccaccgtcac
gataccgccggcggcagcgctctgcttggccagactcgcctgtcggtcatcgatctgtct
gaacaggcaagccagccgatgtactcgccagatggccgctacgggctgatcttcaacggc
gaaatatacaactacattgaattgcgggaagaactggcacgtgccggcaggaatttccat
actcagtccgacaccgaggtcctgcttgctgcatgggaggcatggggagaggcggcgcta
cgacgtcttaccggcatgttcgcctttgccgtgttcgacttccagctccggacctgcacg
ctggtgcgcgatgcattcggcatcaagccgttattttacgcgtccacgggagaaggcttc
tactttgcatcggacacccgtgccatgcgtgcgctggccccatgctcgccggcactgaac
tggcagcgtgcctacgattatctggtgcacggcgaatacgatttcggcaacgaaacgttc
ttcagcgaattctccagtctcagtccggggcacatgatcgaagtgcctctggaccaggct
cgcaccatgttgccgcgatgctggtggaaaccctcaatcatcaaggattccacaagctcc
ttcgaagaagccagcatgcagttgcgcgagctgttgttggagagtgtgaaacttcatctg
cgcagcgacgtccctttgggcgcggcattatcgggaggtattgactcgtcagtcatcgtg
tgcgccatgcggcagatcgaacccgatctgccgatccatacgttcagtttcgtcgccagc
gaaagcgccgtatctgaagaacactgggtggacctggtcaataagcatgttggcgcaata
gcgcacaaagtacacgtaacaccagaggagcttgcccatgatctggagagtctcatcgac
actcagggcgagcccttcggcagcaccagcatctatgcgcaatatcgcgttttcaagctg
gcacagcaaaacggcgtcactgtcacgctggatggtcagggggccgacgagatgatgggc
ggctataacggctatccaggacagcggatgctgagtctgctggataaaggtgcttatgtc
caggcgttgacgttcctgcgcaattgggccgcctggcctggaagaagcccgattgagggt
ctcaaacgcctggtcggcgcaggcagttcggggcaattcaacagcattctgcgccgcctc
aacggaatgcagaacatccctgactggatccgccctgggccattgcgcgaagcaggtgta
cgcctgagctatccgcaagcccagccaattgcacccgatcacgggcgcaggatgatggca
ttcctggcgcaatccttgaccgagcgtggactgctgggacttctaaggcacggtgaccgc
aattcgatgcgtttctccgtcgaaagtcgcgtccccttcctcacgaccggactggttgaa
ttcatgctgcgccaacctgaagaatatcttgtctcccccagcggagaaaccaaggccctg
ttacgcgcgtcaatgcgcggcatcgttcctgacgcagtgctggaccgccgggacaaaatc
ggttttgccactcccgaaaaagcctggatgttcagtatggcagacaccgtccgccagtgg
ctggccgacgatacgggattgccttttcttgatcaagcggcgatatgcgaacacttcgag
cagatcctcgctggcaaacgtccctacacctggcaagtgtggcgctggatcaatttcatt
cgttggtacaaaggcctgaactag

DBGET integrated database retrieval system