KEGG   Herbaspirillum seropedicae: Hsero_4622Help
Entry
Hsero_4622        CDS       T01268                                 

Definition
cytochrome c2 protein
Orthology
K08738  
cytochrome c
Organism
hse  Herbaspirillum seropedicae
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Hsero_4622
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hsero_4622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5306938..5307315)
Genome map
AA seq 125 aa AA seqDB search
MRPHPCLPLALVLVLAPWSALAAGDVAAGRAAFAKCASCHAVGPSARAGFGPQLSNVIGR
KAGSTPDFKYSPAMANAGFVWTEDKLRAFLKAPSDVVPGNKMRFWGIGSDKQIDDILAYL
RTFKP
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccccatccctgcctgcccctcgcccttgtcctcgtcctcgcaccctggtcggcg
ctggcggcgggggatgtggcggccggccgcgccgccttcgccaaatgcgccagttgccat
gccgtgggcccctcggcgcgggccggctttggcccgcaactgagcaatgtgatcgggcgc
aaggccggttccacccctgacttcaagtattccccggcgatggccaacgccggtttcgtc
tggactgaagacaagctgcgcgccttcctcaaggcgcccagcgatgtcgtgccaggcaac
aagatgcgtttctggggcatcggcagcgacaagcagatcgatgacatcctggcctacctg
cgaactttcaaaccatag

DBGET integrated database retrieval system