KEGG   Herbaspirillum seropedicae SmR1: Hsero_4622Help
Entry
Hsero_4622        CDS       T01268                                 

Definition
(GenBank) cytochrome c2 protein
  KO
K08738  cytochrome c
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hse00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hsero_4622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 CCP_MauG
Motif
Other DBs
NCBI-ProteinID: ADJ66088
UniProt: D8IXW6
Position
complement(5306938..5307315)
Genome map
AA seq 125 aa AA seqDB search
MRPHPCLPLALVLVLAPWSALAAGDVAAGRAAFAKCASCHAVGPSARAGFGPQLSNVIGR
KAGSTPDFKYSPAMANAGFVWTEDKLRAFLKAPSDVVPGNKMRFWGIGSDKQIDDILAYL
RTFKP
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccccatccctgcctgcccctcgcccttgtcctcgtcctcgcaccctggtcggcg
ctggcggcgggggatgtggcggccggccgcgccgccttcgccaaatgcgccagttgccat
gccgtgggcccctcggcgcgggccggctttggcccgcaactgagcaatgtgatcgggcgc
aaggccggttccacccctgacttcaagtattccccggcgatggccaacgccggtttcgtc
tggactgaagacaagctgcgcgccttcctcaaggcgcccagcgatgtcgtgccaggcaac
aagatgcgtttctggggcatcggcagcgacaagcagatcgatgacatcctggcctacctg
cgaactttcaaaccatag

DBGET integrated database retrieval system