KEGG   Herbaspirillum seropedicae: Hsero_4746Help
Entry
Hsero_4746        CDS       T01268                                 

Gene name
folE
Definition
GTP cyclohydrolase I protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hse  Herbaspirillum seropedicae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hse00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5443175..5443939)
Genome map
AA seq 254 aa AA seqDB search
MARPHSIMATEKKPAQAIQDVAAPSVHEQLVSARIRQRIKAAGVRFHANDNISAFIKEGE
LAELQAEVQGKLAAVLESLVIDVESDHNTQDTAKRVAKMYLNEVFKGRYQAAPPVTEFPN
IERLNELMIVGPITVRSACSHHLCPIMGKVWVGVMPNEHSNLIGLSKYARLLEWVMSRPQ
IQEEAVSQAADLLMQKLQPDGLAIVMEADHFCMHWRGVKDMDSKMINSVMRGSFLRDANL
RREFLALITQRQRG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcggccgcattccatcatggcaacagaaaaaaaaccggcccaggccatccaggat
gtggctgcacccagcgtgcatgagcagctggtgtcggcccgcatccgccagcgcatcaag
gccgccggcgtgcgcttccacgccaatgacaacatctccgccttcatcaaggaaggcgag
ctggccgagctgcaggccgaagtgcagggcaagctggctgcggtgctggagagcctggtc
atcgatgtggagagtgaccacaacacccaggacaccgccaagcgcgtggccaagatgtat
ctcaatgaagtcttcaagggccgctaccaggcggctcccccggtcaccgagttccccaac
atcgagcgcctcaacgagctgatgatcgtcggtcccattaccgtgcgcagcgcctgttcg
caccacctgtgcccgatcatgggcaaggtctgggtgggggtgatgcccaacgagcattcc
aacctgatcggcctgtccaagtatgcgcgtctgctggagtgggtgatgagccgcccgcag
atccaggaagaagcggtctcgcaggccgccgacctgctgatgcagaagctgcagccggac
ggcctggccatcgtcatggaagccgatcacttctgcatgcactggcgcggcgtcaaggac
atggattcgaagatgatcaacagcgtcatgcgcggctccttcctgcgcgacgccaacctg
cgccgtgaattcctggctttgatcacccaacgtcaacgaggttaa

DBGET integrated database retrieval system