KEGG   Halobacterium salinarum: OE1470FHelp
Entry
OE1470F           CDS       T00662                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hsl  Halobacterium salinarum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hsl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OE1470F (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OE1470F (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OE1470F (trpB)
Enzymes [BR:hsl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OE1470F (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
231440..232732
Genome map
AA seq 430 aa AA seqDB search
MSTNTDDTTRTDGTFGDYGGQYVPEVLMPAVEELTDAYERYVLDNEDGFVDDFRQRIRSF
GGRPTPLTHAPTLSQRHGVDVYLKREDLLHGGAHKLNNALGQVLLAKYMGKDRIVAETGA
GQHGTATAMACAALEMPCEIYMGRTDVNRQRPNVFRMRLHDADVNPVTVGSGTLKEAINE
TMRDWATNVADTHYVIGSVVGPHPFPSMVRDFQAIISEELRAQSREQLGELPAAVIACAG
GGSNTMGAFGAFVGSASLPGAPAGTHEPAPDVDLLAVEAGGSRLGVDDDAGYAPNSASLS
TGTEGVLHGARTKLLQTETGQIVESHSVSAGLDYAGVGPELAHLVDTGRITPTNVDDDAA
LAAFHRLSRDEGVIPALETSHAVAALDQYDGDGPVVVNVSGRGDKDLDTVIEASAANDID
AAPDMEVFEQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaacaccgacgacacgacacggacggacggaacgttcggggactacggcggc
cagtacgtccccgaggtactgatgcccgcagtcgaggaactgaccgacgcctacgagcgg
tacgtcctggacaacgaggacggcttcgtggacgacttccgccagcgaatccgctcgttc
ggcgggcggcccacgccgctgacccacgccccgacgctcagccagcgccacggcgtcgac
gtctacctcaaacgcgaggacctcctgcacggcggcgcgcacaaactcaacaacgccctg
gggcaggtgttgctcgccaaatacatgggcaaagaccgcatcgtcgcggagaccggggcc
ggccagcacggcaccgcaaccgcgatggcctgtgccgccctggagatgccatgcgagatc
tacatggggcgcaccgacgtgaaccgccagcgccccaacgtcttccggatgcggctgcac
gacgccgacgtgaacccggtgaccgtcggctcggggacgctgaaagaggccatcaacgag
acgatgcgtgactgggcgacgaacgtcgcggacacccactacgtcatcgggtcggtcgtc
ggcccacacccgttcccgtcgatggtgcgggacttccaggcgatcatcagcgaggagctg
cgcgcgcagtcccgcgagcagctcggcgaactcccggccgccgtcatcgcgtgcgccggc
ggcggctcgaacaccatgggtgcgttcggcgcgttcgtcgggagcgccagcctgccgggg
gctccggcgggcacacacgagccggcccccgacgtggacctgctggccgtcgaagccggc
ggctcgcgcctcggcgtcgacgacgacgcggggtacgcgccgaactccgccagcctctcg
acgggcaccgagggcgtcctgcacggcgcgcgcacgaaactccttcagacggagaccggc
cagatcgtggaatcacactccgtgtccgccggcctcgactacgcgggggtcggcccggag
ctggcacacctcgtcgacaccggccgcatcacacccaccaacgtcgacgacgacgccgcg
ctcgcggcgttccaccggctgtcgcgcgacgagggcgtgatccccgccctcgaaacgagc
cacgcggtcgccgccctcgaccagtacgacggcgacggtcccgtggtggtgaacgtctcc
ggccggggggacaaggatctggacaccgtcatcgaggcgtcggcggccaacgacatcgac
gccgcgccggacatggaggtgttcgagcagtga

DBGET integrated database retrieval system