KEGG   Halobacterium salinarum: OE1471FHelp
Entry
OE1471F           CDS       T00662                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hsl  Halobacterium salinarum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hsl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OE1471F (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OE1471F (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OE1471F (trpA)
Enzymes [BR:hsl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OE1471F (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
232729..233559
Genome map
AA seq 276 aa AA seqDB search
MTRSDLAAAFDDGPALVSYVVAGDPTPAATAEYIDALVDGGTDVIELGLPFSEPVAEGTT
IQNAIKRALDAGMTPDAYLDLVARIDADVPVVCMTYYNLLFQYGDRAGPAAFVSAAAEAG
VSGFVVPDLPVDESGPLREACRAHGLDLVFVVAPTTTADRRERMLDLTTGFVYVQGRVGT
TGAREEVSAATPDALAALQHTDIPKAVGFGVSSGEQAREITASGADGVIVGSAYVDTVAD
GVADDDPPSVVADRLRDLAAELKAGAARGVPEPEHK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcagcgacctcgccgcggccttcgacgacggcccggcgctggtgtcgtacgtg
gtcgcgggcgatccgacgcccgccgcgaccgccgagtacatcgacgcgctcgtggacggc
ggcacggacgtgatcgaactcgggctgccgttcagcgaacccgtcgcggaggggacaacc
atccagaacgcgatcaagcgcgcgctcgatgccggcatgacgcccgacgcctacctggat
ctcgtggcgcgcatcgacgccgacgtgccggttgtctgtatgacctactacaacctcctg
ttccagtacggcgaccgcgccgggcccgcggcgttcgtctccgcggcggccgaggcgggc
gtctccgggttcgtggttccggatctgcccgtcgacgagtccggcccgctccgggaggcg
tgtcgcgcccacggcctcgatctcgtgttcgtcgttgcgccgacgaccaccgccgaccgc
cgcgagcgcatgctcgatctgaccaccgggttcgtctacgtgcagggccgggtcggcacg
acgggtgcccgtgaggaagtcagcgcggcgacgccggacgcgctcgcggccctccagcac
acggacatcccgaaggccgtggggttcggcgtctcctcgggcgagcaggcccgcgagatc
acggccagcggtgctgacggcgtcatcgtggggagcgcgtacgtcgacacggtcgccgac
ggtgttgccgacgacgacccccccagcgtggtcgccgatcgcctgcgggacctcgccgcc
gagctgaaggccggcgccgctcggggcgtgccggaaccggaacacaaatag

DBGET integrated database retrieval system