KEGG   Halobacterium salinarum: OE1615RHelp
Entry
OE1615R           CDS       T00662                                 

Gene name
folCP
Definition
folylpolyglutamate synthase / 7,8-dihydropteroate reductase / dihydropteroate synthase (EC:2.5.1.15 6.3.2.17)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hsl  Halobacterium salinarum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OE1615R (folCP)
Enzymes [BR:hsl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     OE1615R (folCP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(310574..313021)
Genome map
AA seq 815 aa AA seqDB search
MRYDEAANFLLDLRRYGPKPGTESTADLLASLGDPHQDGPDYVQIAGSNGKGSTARFTES
ILRAAGLDVGLYTSPHFDDVRERVTVNGRRMSKAALTTFIETITPYVTERAADGAAPTYF
EVVTAMALWQFSRADVDVAVLEVGIGGRLDATSVVDPSASAVTSVTLEHTDVLGETIPEI
ARDKAHVAPAGDTPLVTATTDDALAAVRDHAGAVRTVGDTAGRDVTATYEGRTNHTEAAV
SITGDDWSVATEIPLLGDHQAENAGVAAALARQTAGVDDDAIARGLRSAHWPGRFEVMGA
DPVVVLDGAHNPGACGAVAETVAEFDYDRLLTVFGAMHDKDHGAMAAALPTPDHVWACEP
VPDRAEDADVLAAVFEDAGAGTVSVTRAVESAVADAIAEATADDLVLVAGSLFAVAEART
RWTRTFAETDVDSLDDARDALERAHVTPPGVWRMRGKGVHRVVKTRVQTRQAQYLKEELL
SLGGECSVSGLNAQSGAMVDAVMMATMAQFKRLCEKLDGQPYGLSEVGADLRESLGIQAA
PATHGYPWEGERTAVMGILNVTPDSFHDGGEYDALEDAVARAESMAENGVDVIDIGGEST
RPGADAVSVADELDRVLPVIERISDLDVLLSVDTRKAEVARQALEAGADILNDVTGLDDP
EMRFVAAEYDAPIVVMHSIDAPVDPDSDPDYDDVVDDVIAELTERVLLAEKAGVPRERII
VDPGLGFGKSAAEGFELLDRADEFHALGGPVLVGHSHKSMFGAVDRYPDEGGYATAAASA
LAADRGADIVRVHDVPENVAAVRVAEATRTGADAE
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgacgaagcggcgaacttcctgctggacctccggcggtacgggccgaaaccg
gggaccgagtcgacggcggacctgcttgccagcctcggcgacccacaccaggacggcccc
gactacgtgcagatcgcggggtccaacgggaagggatcgaccgcacggttcacggagtcc
atcctccgggcggccggcctggacgtggggctgtacacgtcgccgcatttcgacgacgtg
cgcgagcgggtgaccgtcaacggccgccgcatgtcgaaggcggcgctgacgacgttcatc
gagacgatcacgccgtacgtgaccgagcgcgcggccgacggggccgcgccgacgtacttc
gaggtcgtgaccgcgatggcgctgtggcagttcagccgcgcggacgtggacgtggcggtg
cttgaggtcgggatcggcggccgcctggacgcgaccagtgtggtggacccgtcggcgagc
gccgtcacgtcggtgaccctcgaacacaccgacgtgctcggggagacgatccccgagatc
gcgcgggacaaagcccacgtcgcgccggcgggcgatacgccgctggtgaccgcgaccacc
gacgatgcgctggcggccgtgcgcgaccacgcgggtgccgtccgcactgtcggcgacacc
gcggggcgcgacgtgaccgcgacctacgaggggcgcaccaaccacaccgaggccgcggtc
tcgatcaccggcgacgactggtcggtggccaccgagatcccgctgctgggcgaccaccag
gccgagaacgcgggcgtcgcggcggcgctggcgcgacagacggcgggcgtcgacgacgac
gccatcgcgcgcgggctgcggagcgcgcactggccggggcgcttcgaggtgatgggggcc
gaccccgtggtggtgttggacggcgcgcacaacccgggggcgtgtggtgccgtcgcggag
acggtcgccgagttcgactacgaccgcctgctgaccgtgttcggcgcgatgcacgacaag
gatcacggggcgatggcggccgcgctcccgacgcccgaccacgtgtgggcgtgcgagccg
gtgcccgaccgtgcggaggacgccgacgtgctcgcggcggtgttcgaggacgccggcgcg
ggaaccgtgagcgtgacgcgggccgtggagtcggcggtcgcggacgcgatcgcggaggcg
accgcggacgacctcgtgctcgtcgcgggatcgctgttcgcggtcgcggaagcccggacc
cggtggacgcgcacgttcgcggagaccgacgtcgacagcctcgacgacgcgcgggacgcg
cttgagcgcgcgcacgtgacgccgccgggggtgtggcggatgcgcgggaagggcgtccac
cgcgtggtgaaaaccagggtgcagacgcggcaggcccagtacctcaaagaggagctgttg
agcctcggcggggagtgttcggtgtcggggctgaacgcgcagtccggggcgatggttgac
gccgtcatgatggcgacgatggcgcagttcaagcgcctctgtgagaaactcgacgggcag
ccctacggcctcagcgaggtcggcgcggacctccgggagtcgctgggcatccaggcggca
ccggccacgcatggctacccctgggagggcgagcgcaccgccgtgatgggcatcctgaac
gtcacgccggacagcttccacgacggcggcgagtacgacgccctcgaagacgcggtcgcg
cgcgccgagtcgatggccgaaaacggcgtcgacgtcatcgacatcggcggggagtccacg
cgccccggtgccgacgccgtcagcgtcgccgacgaactcgatcgggtgctcccggtgatc
gagcggatcagcgacctggacgtgttgctgtcggtggacacccggaaagccgaggtcgcg
cggcaggccctggaggcgggggcggacatcctcaacgacgtgaccgggttggacgacccc
gagatgcggttcgtggccgccgagtacgacgccccgatcgtcgtgatgcattcgatcgac
gcgccggtcgaccccgacagcgatcccgactacgacgacgtggtcgacgacgtcatcgcg
gagctcaccgagcgcgtgctgctcgccgagaaggccggcgtcccccgcgagcggatcatc
gtcgaccccgggctcgggttcggcaaaagcgccgccgagggcttcgagttgctggaccgc
gccgacgagttccacgcgctcggcggccccgtgctggtcgggcacagccacaagtcgatg
ttcggcgcggtcgaccgctacccggacgaaggcgggtacgcgaccgcggccgcgtcggcg
ctggcggccgaccgcggcgcggacatcgtgcgcgtccacgacgtgcccgagaacgtcgcc
gccgtccgggtcgccgaggcaacccggaccggtgcggacgcggagtga

DBGET integrated database retrieval system