KEGG   Halobacterium salinarum: OE2450FHelp
Entry
OE2450F           CDS       T00662                                 

Gene name
acs2
Definition
acyl-CoA synthetase (EC:6.2.1.-)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hsl  Halobacterium salinarum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OE2450F (acs2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OE2450F (acs2)
   00620 Pyruvate metabolism
    OE2450F (acs2)
   00640 Propanoate metabolism
    OE2450F (acs2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    OE2450F (acs2)
   00680 Methane metabolism
    OE2450F (acs2)
Enzymes [BR:hsl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     OE2450F (acs2)
Lipid biosynthesis proteins [BR:hsl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   OE2450F (acs2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
755129..757132
Genome map
AA seq 667 aa AA seqDB search
MSNDTDTPELEARLTDQDEFTPPESFVEQANVSDPGIYDEFDATWPECWTDAADLLDWET
PYDQVLDDSNPPFYEWFPGGGLNASANCLDRHLDERGDEAAIEWVGEPADEANRTYTYAQ
LHREVNEFAAGLREMGVGEDDIVTLYMPMVPELPIAMLACARLGAPHSVVFAGFSADALS
TRMNAADSEYLVTCDGYYRRGDPLDHYAKTLDGLDGVSHAVSDVVVVDRLGANGDGFDHD
RPAAHHDYDAVVAAHDGASVSPVERDATDMLFLMYTSGTTGQPKGVTHSTGGYLSWAAWT
SQAVLDIKPSDTYFCSADIGWITGHSYIVYGPLALGTTTMLYEGAPDHPDKDRLWELVES
YEATQLYTAPTAIRSFMKWGVEYPDAHDLSSLRLLGTVGEPINPRAWTWYYTHIGDESCP
IVDTWWQTETGGMMVTGLPGVSTMKPGSAGRPLPGVDARVIDTDGDDVAGGRAGHLTIQK
PWPGMLQTLYENDERFIDEYWRVYSDTDSGDSADWVYFPEDGAKVDDDGYITVLGRVDDV
VNVSGHRLGTMEIESAIVDVPGVAEAAVVGGDHDLKGEAVYAYVLTTDDHDASDALRERI
VASVEDAIGPIARPEAVVFAPELPKTRSGKIMRRLLEDIANDADLGDTSTLRNPDVVETI
QDQLAGD
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgacaccgacaccccggagctggaggcgcgactcaccgaccaggacgagttc
acgccgcccgagtcgttcgtcgagcaggcgaacgtctccgacccgggtatctacgacgag
ttcgatgcgacctggcccgaatgctggactgacgcggccgacctgctggactgggagacg
ccgtacgatcaggtcctcgacgattcgaacccgccgttctacgagtggttcccgggcggc
ggcctgaacgcgagcgcgaactgtctggaccgccacctcgacgagcgcggcgacgaggcc
gccatcgagtgggtgggcgagccggccgacgaagccaaccgcacgtacacgtacgcccag
ctccaccgggaggtcaacgagttcgccgccgggctgcgcgagatgggtgtcggcgaggac
gacatcgtcacgctgtacatgccgatggtgcccgagttgccgatcgcgatgctggcctgc
gcgcgcctcggcgcgccacactcggtggtgttcgcgggcttctccgcggacgcgctcagc
acgcgaatgaacgccgccgactcggagtatctcgtcacctgcgacggctactaccggcgc
ggcgaccccctcgatcactacgcgaaaacgctcgacggcctggatggggtgtcacacgcg
gtcagtgacgtggtcgtcgtcgaccgcctcggcgcgaacggcgacggcttcgaccacgac
cgcccggccgcacaccacgactacgacgccgtcgtcgccgcccacgacggtgcaagcgtc
tcgccggtcgagcgcgacgccaccgacatgctgttcctgatgtacacgtcgggcaccacc
ggccagcccaaaggcgtcactcactccacgggcggctacctctcgtgggccgcctggacc
tcgcaggcggtcctggacatcaagccgtctgacacctacttctgctcggcggacatcggc
tggatcaccggccactcctacatcgtctacgggcccctggcgcttggcaccacgacgatg
ctctacgagggcgctccggaccaccccgacaaggaccgcctgtgggagctcgtcgagtcc
tacgaggcaacccaactgtacaccgcgccgacggcgatccggtcgttcatgaaatggggg
gtggagtaccccgacgcccacgacctctccagcctgcggctgctcggaaccgtcggggag
ccgatcaacccacgggcctggacgtggtattacacccacatcggcgacgagtcgtgcccg
atcgtggacacgtggtggcagaccgagaccggcggcatgatggtcacggggctgcccggc
gtctccacgatgaaaccggggtcggcgggccgcccactgccgggcgtcgacgcgcgcgtc
atcgacaccgacggcgacgacgtggcgggcgggcgggcgggccacctgaccatccagaag
ccgtggccggggatgctccaaaccctctacgagaacgacgagcggttcatcgacgagtac
tggcgggtatactccgacaccgacagcggcgactccgcggactgggtgtacttcccggag
gacggtgcgaaagtcgacgacgacggctacatcacggtcctggggcgcgtcgacgacgtg
gtgaacgtctccgggcaccgcctgggcacgatggagatcgaatcggccatcgtcgacgtg
ccgggggttgcggaggcggcggtcgtcggcggcgaccacgacctgaaaggcgaagccgtg
tacgcgtacgtgctcaccacggacgaccacgacgccagcgacgccctccgtgagcgcatc
gtggccagcgtggaggacgccatcggccccatcgcgcgcccggaggcggtcgtgttcgcg
ccggaactcccgaagacgcggtcggggaagatcatgcgccggctcctggaggacatcgca
aacgacgccgacctcggggacacctcgacgctccggaaccccgacgtggtggagacgatt
caggaccagctggccggcgactga

DBGET integrated database retrieval system