KEGG   Halobacterium salinarum: OE2450FHelp
Entry
OE2450F           CDS       T00662                                 

Gene name
acs2
Definition
(RefSeq) acyl-CoA synthetase (EC:6.2.1.-)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hsl  Halobacterium salinarum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OE2450F (acs2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OE2450F (acs2)
   00620 Pyruvate metabolism
    OE2450F (acs2)
   00640 Propanoate metabolism
    OE2450F (acs2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    OE2450F (acs2)
   00680 Methane metabolism
    OE2450F (acs2)
Enzymes [BR:hsl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     OE2450F (acs2)
Lipid biosynthesis proteins [BR:hsl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   OE2450F (acs2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
755129..757132
Genome map
AA seq 667 aa AA seqDB search
MSNDTDTPELEARLTDQDEFTPPESFVEQANVSDPGIYDEFDATWPECWTDAADLLDWET
PYDQVLDDSNPPFYEWFPGGGLNASANCLDRHLDERGDEAAIEWVGEPADEANRTYTYAQ
LHREVNEFAAGLREMGVGEDDIVTLYMPMVPELPIAMLACARLGAPHSVVFAGFSADALS
TRMNAADSEYLVTCDGYYRRGDPLDHYAKTLDGLDGVSHAVSDVVVVDRLGANGDGFDHD
RPAAHHDYDAVVAAHDGASVSPVERDATDMLFLMYTSGTTGQPKGVTHSTGGYLSWAAWT
SQAVLDIKPSDTYFCSADIGWITGHSYIVYGPLALGTTTMLYEGAPDHPDKDRLWELVES
YEATQLYTAPTAIRSFMKWGVEYPDAHDLSSLRLLGTVGEPINPRAWTWYYTHIGDESCP
IVDTWWQTETGGMMVTGLPGVSTMKPGSAGRPLPGVDARVIDTDGDDVAGGRAGHLTIQK
PWPGMLQTLYENDERFIDEYWRVYSDTDSGDSADWVYFPEDGAKVDDDGYITVLGRVDDV
VNVSGHRLGTMEIESAIVDVPGVAEAAVVGGDHDLKGEAVYAYVLTTDDHDASDALRERI
VASVEDAIGPIARPEAVVFAPELPKTRSGKIMRRLLEDIANDADLGDTSTLRNPDVVETI
QDQLAGD
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgacaccgacaccccggagctggaggcgcgactcaccgaccaggacgagttc
acgccgcccgagtcgttcgtcgagcaggcgaacgtctccgacccgggtatctacgacgag
ttcgatgcgacctggcccgaatgctggactgacgcggccgacctgctggactgggagacg
ccgtacgatcaggtcctcgacgattcgaacccgccgttctacgagtggttcccgggcggc
ggcctgaacgcgagcgcgaactgtctggaccgccacctcgacgagcgcggcgacgaggcc
gccatcgagtgggtgggcgagccggccgacgaagccaaccgcacgtacacgtacgcccag
ctccaccgggaggtcaacgagttcgccgccgggctgcgcgagatgggtgtcggcgaggac
gacatcgtcacgctgtacatgccgatggtgcccgagttgccgatcgcgatgctggcctgc
gcgcgcctcggcgcgccacactcggtggtgttcgcgggcttctccgcggacgcgctcagc
acgcgaatgaacgccgccgactcggagtatctcgtcacctgcgacggctactaccggcgc
ggcgaccccctcgatcactacgcgaaaacgctcgacggcctggatggggtgtcacacgcg
gtcagtgacgtggtcgtcgtcgaccgcctcggcgcgaacggcgacggcttcgaccacgac
cgcccggccgcacaccacgactacgacgccgtcgtcgccgcccacgacggtgcaagcgtc
tcgccggtcgagcgcgacgccaccgacatgctgttcctgatgtacacgtcgggcaccacc
ggccagcccaaaggcgtcactcactccacgggcggctacctctcgtgggccgcctggacc
tcgcaggcggtcctggacatcaagccgtctgacacctacttctgctcggcggacatcggc
tggatcaccggccactcctacatcgtctacgggcccctggcgcttggcaccacgacgatg
ctctacgagggcgctccggaccaccccgacaaggaccgcctgtgggagctcgtcgagtcc
tacgaggcaacccaactgtacaccgcgccgacggcgatccggtcgttcatgaaatggggg
gtggagtaccccgacgcccacgacctctccagcctgcggctgctcggaaccgtcggggag
ccgatcaacccacgggcctggacgtggtattacacccacatcggcgacgagtcgtgcccg
atcgtggacacgtggtggcagaccgagaccggcggcatgatggtcacggggctgcccggc
gtctccacgatgaaaccggggtcggcgggccgcccactgccgggcgtcgacgcgcgcgtc
atcgacaccgacggcgacgacgtggcgggcgggcgggcgggccacctgaccatccagaag
ccgtggccggggatgctccaaaccctctacgagaacgacgagcggttcatcgacgagtac
tggcgggtatactccgacaccgacagcggcgactccgcggactgggtgtacttcccggag
gacggtgcgaaagtcgacgacgacggctacatcacggtcctggggcgcgtcgacgacgtg
gtgaacgtctccgggcaccgcctgggcacgatggagatcgaatcggccatcgtcgacgtg
ccgggggttgcggaggcggcggtcgtcggcggcgaccacgacctgaaaggcgaagccgtg
tacgcgtacgtgctcaccacggacgaccacgacgccagcgacgccctccgtgagcgcatc
gtggccagcgtggaggacgccatcggccccatcgcgcgcccggaggcggtcgtgttcgcg
ccggaactcccgaagacgcggtcggggaagatcatgcgccggctcctggaggacatcgca
aacgacgccgacctcggggacacctcgacgctccggaaccccgacgtggtggagacgatt
caggaccagctggccggcgactga

DBGET integrated database retrieval system