KEGG   Halobacterium salinarum: OE2500RHelp
Entry
OE2500R           CDS       T00662                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hsl  Halobacterium salinarum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OE2500R (tpiA)
   01230 Biosynthesis of amino acids
    OE2500R (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OE2500R (tpiA)
   00051 Fructose and mannose metabolism
    OE2500R (tpiA)
   00562 Inositol phosphate metabolism
    OE2500R (tpiA)
Enzymes [BR:hsl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OE2500R (tpiA)
Exosome [BR:hsl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OE2500R (tpiA)
  Exosomal proteins of bladder cancer cells
   OE2500R (tpiA)
  Exosomal proteins of melanoma cells
   OE2500R (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(778519..779163)
Genome map
AA seq 214 aa AA seqDB search
MFVLVNLKAYPCDPVAIAEAAADVAETTPATIAVAPQPADIGRVADTGATTYAQHVSPTE
HGSHTGSVLAESVADNGAVGTLLNHSEHRRRLADIDGSVAAAERAGLDTVVCANNPAQVA
AAAALGPDAVAVEPPALIGTGTPVSQADPDIVSDAVAAAEAVDPSVDVYCGAGITTGEDV
VSAGDLGASGVLLASGVAKADDPRAALADLVAPL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttctcgtcaacctcaaggcgtacccctgtgatccggtcgccatcgcggaggcg
gctgccgacgtcgctgagacgaccccagccacgatcgcggtcgcaccccagcccgcggac
atcggtcgcgtcgcggacacgggtgccaccacgtacgcccaacacgtcagcccgaccgag
cacggcagccacaccggcagcgtgctcgcggagtcggtcgcggacaacggcgctgtgggc
acgctgctgaaccactccgagcaccgccgccggctcgccgacatcgacggcagcgtcgcg
gccgccgagcgcgccggcctcgacacggtggtgtgcgcgaacaaccccgcacaggtcgcc
gccgccgccgcgctcggccccgacgcggtggccgtcgagccgccggcgctgatcggcacc
ggcacgccggtctcgcaggccgatccggacatcgtctccgacgccgtcgccgcggcggaa
gcggtcgatccgagcgtggacgtctactgcggcgcgggcatcaccaccggcgaggacgtc
gtgtcggccggcgacctcggcgccagcggcgtcctgctcgccagcggggtggcgaaggcc
gacgacccgcgcgcggcgctggcggacctcgtcgcgccgctgtag

DBGET integrated database retrieval system