KEGG   Halobacterium salinarum: OE2867RHelp
Entry
OE2867R           CDS       T00662                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase subunit D (membrane anchor protein) (EC:1.3.99.1)
  KO
K00242  
succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
hsl  Halobacterium salinarum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OE2867R (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OE2867R (sdhD)
   00650 Butanoate metabolism
    OE2867R (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    OE2867R (sdhD)
   00720 Carbon fixation pathways in prokaryotes
    OE2867R (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(971287..971649)
Genome map
AA seq 120 aa AA seqDB search
MAKRYSSFRSGSTTWLLQRLTAGFLVVVLAFHFFNLHFVNHAYNIDFAGSQVRMQSLGYY
VTMVLFLVTATFHGVNGVYNALVNQGIEGNAKRAAQLVLGVAGVLLIVQGIRVANALAGF
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacgatactcctcgttccgatcgggatcgacgacgtggctgctccagcggctg
accgctgggttcctcgtcgtggtgttggcgttccacttcttcaacctgcacttcgtcaat
cacgcctacaacatcgacttcgccggcagccaggtccggatgcagagcctcggctactac
gtcacgatggtgttgttcctcgtgacggcgacgttccacggggtcaacggcgtctacaac
gccctcgtgaaccagggcatcgaggggaacgccaagcgcgccgcgcaactcgtgcttggg
gttgccggcgtgctgttgatcgtgcaggggattcgcgtggcgaacgcgcttgcggggttc
tag

DBGET integrated database retrieval system