KEGG   Halobacterium salinarum R1: OE2867RHelp
Entry
OE2867R           CDS       T00662                                 

Gene name
sdhD
Definition
succinate dehydrogenase subunit D (membrane anchor protein) (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hsl  Halobacterium salinarum R1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:hsl01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hsl00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hsl00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsl00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(971287..971649)
Genome map
AA seq 120 aa AA seqDB search
MAKRYSSFRSGSTTWLLQRLTAGFLVVVLAFHFFNLHFVNHAYNIDFAGSQVRMQSLGYY
VTMVLFLVTATFHGVNGVYNALVNQGIEGNAKRAAQLVLGVAGVLLIVQGIRVANALAGF
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacgatactcctcgttccgatcgggatcgacgacgtggctgctccagcggctg
accgctgggttcctcgtcgtggtgttggcgttccacttcttcaacctgcacttcgtcaat
cacgcctacaacatcgacttcgccggcagccaggtccggatgcagagcctcggctactac
gtcacgatggtgttgttcctcgtgacggcgacgttccacggggtcaacggcgtctacaac
gccctcgtgaaccagggcatcgaggggaacgccaagcgcgccgcgcaactcgtgcttggg
gttgccggcgtgctgttgatcgtgcaggggattcgcgtggcgaacgcgcttgcggggttc
tag

DBGET integrated database retrieval system