KEGG   Halobacterium salinarum R1: OE2921RHelp
Entry
OE2921R           CDS       T00662                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hsl  Halobacterium salinarum R1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hsl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(995952..997070)
Genome map
AA seq 372 aa AA seqDB search
MRTVDAAGLPIGDDYPPRIMGVLNVSKESPYDPSVYDDPEAAAAYVDSELIGEGADIVDV
GLESANKDLDVLSADQERERLQTAIDTIERVEGEAVFSIETRYSEVADEALAAGFDMVND
ICGFADPEMPAVCEAHDVAVAKMASPPDLERPGAIESVDDIYDALSLHGFTDKTIVDPAF
GGWSTEKTLADDRETFDRLREFRGYGYPMLVSINRKNFLREIAGRDTAGALPVSLAATAM
AVERGAHVVRTHDVAETRDAALIGHEFTPDRTHTSHIEQLDVTTLPAAMRHADRLGADGA
ADAVARAYEVTGLSADDRDALAATGVAVSGTDPTLVAGTAGALREAGAGLAAATDGDSVL
ATLAEIFRTAGE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaccgtcgacgcagccgggctgcccatcggtgacgactacccgccacgaatcatg
ggcgtgttgaacgtatcgaaggagtcgccgtacgacccgagcgtgtacgacgaccccgag
gcggcggccgcgtacgtcgactcggagctgatcggggagggcgctgacatcgtcgatgtc
ggcctggagtccgcgaacaaggacctcgacgtgctgtcggccgaccaggagcgcgagcgc
ctccagacggccatcgacaccatcgagcgcgtcgagggggaggcggtgttctccatcgaa
acccggtacagcgaggtcgccgacgaggcgctggcggctggcttcgacatggtcaacgac
atctgtgggttcgcggaccccgagatgccggcggtctgtgaggcccacgacgtcgcggtc
gcgaagatggcgagcccgccggacctcgaacgcccgggggccatcgaatccgtcgacgac
atctacgacgcgctgtcgctgcacgggttcaccgacaagaccatcgttgatccggcgttc
ggcgggtggagcaccgagaagacgctggccgacgaccgcgagacgttcgaccggctgcgg
gagttccgcgggtacggctacccgatgttggtttcgatcaaccgcaagaacttcctgcgg
gagatcgccggccgggacacggcgggggcgctgccggtgtcgctggcggcgaccgcgatg
gccgtcgagcgcggcgcacacgtggttcggacccacgacgtcgccgagacgcgtgacgcg
gcgctcatcggccacgagttcacgcccgaccgcacgcacaccagccacatcgaacagttg
gacgtgacgacgctcccggcggcgatgcgccacgccgaccggctcggcgctgatggggcg
gccgacgccgtcgcgcgcgcctacgaggtcacggggctgtcggccgacgaccgggacgcg
ctggcggcgactggggtcgcggtctccggcacggacccgacgctcgtcgccggcacagcg
ggggcgctccgtgaggctggcgcggggctggcggccgccacggacggcgacagcgtgctt
gcaaccctggcggagatattccggacggccggggagtaa

DBGET integrated database retrieval system