KEGG   Halobacterium salinarum: OE3195FHelp
Entry
OE3195F           CDS       T00662                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hsl  Halobacterium salinarum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OE3195F (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OE3195F (sucC)
   00640 Propanoate metabolism
    OE3195F (sucC)
   00660 C5-Branched dibasic acid metabolism
    OE3195F (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    OE3195F (sucC)
Enzymes [BR:hsl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     OE3195F (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1141501..1142649
Genome map
AA seq 382 aa AA seqDB search
MKLHEYQAKEVFADAGIPTPESALATSVDEAVEVADALDYPVAVKAQVHVGGRGKAGGIK
LAENTAEAREAAESILGMDLKGYTVDRVLVEEAVDFTNELYVGVTMDRSEGAPVVMVSER
GGVDIESVAEEAPEDIVREHVDPSFGLQAYQARNAVYDAGIEQDVAGDVAKIVQGVYDLW
ADSDATEVEINPVMVTSERDVVAADAVMKLDEDALFRQPAFADMEEDAAEDDLEAKANEY
GFDYVRLDGNTGIIGNGAGLVMTTLDLVDYYGGQPANFLDIGGGAKADRVANALDMVFSD
ENVDSVVFNIFGGITRGDEVAKGINSALEQFDEIPTPVVVRLAGTNAAEGREILNDDLVT
VEETLEGAVQRAVEYADEEDIQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcacgagtaccaggcgaaggaggtcttcgccgatgcgggcattccgaccccg
gagtcggcgctcgcaacgtccgtcgacgaggccgtcgaggtcgcagacgccctcgactac
cccgtcgcggtgaaggcccaggtacacgtcggtggccgcggaaaggccggcggcatcaaa
ctcgcggagaacacggccgaggctcgcgaggccgccgagtcgattctcggcatggacctc
aaaggctacacggttgatcgcgttctcgtcgaggaggccgtcgacttcaccaacgagttg
tacgtcggcgtgaccatggaccgcagcgagggcgcgccggtcgtgatggtctccgagcgc
ggcggcgtcgacatcgaatccgtcgccgaggaagcccccgaggacatcgtgcgcgagcac
gtcgatccctcgttcggtctgcaggcctatcaggcccgcaacgccgtctacgacgcgggc
atcgagcaggacgtcgccggggacgtcgcgaagatcgtgcagggcgtctacgatctgtgg
gcggacagcgacgccacggaggtcgagatcaatcccgtgatggtgaccagcgagcgcgac
gttgtcgccgccgacgccgtgatgaaactcgacgaggacgcgttgttccgccagccggcg
ttcgccgacatggaagaggacgccgccgaggacgacctcgaagccaaggccaacgagtac
ggcttcgactacgtccgcctggacggcaacacgggcatcatcggcaacggggccgggctc
gtgatgacgacgcttgacctcgtggactactacggcgggcagcccgcgaacttcctggac
atcggcggcggcgcgaaagccgaccgcgtcgccaacgccctggacatggtgttcagcgac
gagaacgtcgacagcgtcgtgttcaacattttcggcggcatcactcgcggcgacgaggtc
gcgaagggcatcaacagcgcgctcgaacagttcgacgagatcccgacgccggtcgtcgtc
cggctcgcgggcacgaacgccgctgaaggccgcgagatcctcaacgacgacctcgtgacc
gtcgaagaaacgcttgagggcgctgtccagcgcgccgtcgagtacgccgacgaggaggac
atccaatga

DBGET integrated database retrieval system