KEGG   Halobacterium salinarum: OE3229RHelp
Entry
OE3229R           CDS       T00662                                 

Gene name
hmcA
Definition
magnesium chelatase (protoporphyrin IX magnesium-chelatase) (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
hsl  Halobacterium salinarum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OE3229R (hmcA)
Enzymes [BR:hsl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     OE3229R (hmcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1158714..1160786)
Genome map
AA seq 690 aa AA seqDB search
MVDLGRSKKLSPDRRAGAPFPAVVGQDDLKTGLLAVAANASLDGLLVTGEKGTAKSTTAR
ALADLLPDQRAVADCPYGCPPEDPTRQCADCRDRTDPPVESRPVPFVTLPLGASRDRVVG
SLSVTDALAGDAEFSPGLLAAANRGILYVDEVNLLDDHLVDVLLDAAASGVNRVERDGVS
VTHPAEFTLVGTMNPEEGDLRPQFRDRFALRVAVAGSEEIADRVEIMDRALAGFDGDYAA
DTAAVRDRLVTARDLLPDVDLPESLAREIAELCRDAGVDGHRADVATARAARTLAALDGR
PTVTEADIERAAGFALPHRLQSRPFEDAPDPEDVVDDHFDDDGDQSDEEGDAETSDEAGG
DDPEPTDNAEADAEPDGDTGGAEAPTGGPDDSQSEGSQAPADSEAGDDPTDGERGDDEDT
EDAAPLVPGQPRGDTVEPGTGVAPDADAPDAERATGDSGRASATPSPDARGARVRTERAT
PADDVDAAASVRAAAARGSDAVESRDLRQSINAGSASALVVFAVDASASMRGPMRAAKGV
ALDLLRDAYQHRDEIAVVAFAGDDADVLVPPTDSVALAARHLKDLPTGDRTPLPAGLRAA
DDVLARADPDASVVVVVTDGQANATDTPTAATRTAASALAERGAHVVVVDAGDNARGLTS
DIVDAADGERVPLDALSADRVEHAVGQARK
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggttgatttgggacgcagcaaaaagctgtcgcccgaccggcgtgccggcgcgccgttc
cccgccgtcgtcggccaagacgacctcaaaacggggctgctcgccgtcgccgcgaacgcg
tccctggacgggctgctcgtcaccggcgagaagggcaccgcgaagtccaccaccgcccgc
gcgctcgccgacctgctgcccgaccagcgcgccgtcgcggactgcccctacggctgtccg
cccgaggaccccacccggcagtgcgcggactgccgggaccgcaccgacccgccggtcgaa
tcgcgtccggtcccgttcgtcacactccccctgggcgcgtcccgcgaccgcgtcgtcggc
tcgctgtcggtgaccgacgcgctcgccggcgacgccgagttcagcccggggctgttggcc
gcggccaaccgggggatcctctacgtcgacgaagtgaacctcctcgacgaccacctcgtg
gacgtgttgctcgacgccgccgccagcggcgtcaaccgcgtcgaacgcgacggcgtcagc
gtcacccaccccgcggagttcacgctcgtcggcacgatgaaccccgaggagggcgacctc
cgcccgcagttccgcgaccggttcgcgctccgcgtcgccgtcgcgggcagcgaggagatc
gccgaccgcgtcgagatcatggaccgcgcgctcgcgggcttcgacggcgactacgccgcc
gacaccgccgccgtccgcgaccgcctggtgaccgcccgcgacctgctgcccgacgtcgac
ctccccgagtcgctggcccgcgagatcgccgaactctgccgggacgccggcgtcgacggg
caccgcgccgacgtggccaccgcccgcgccgcccgcacgctcgcggcgctcgacggccgc
ccgacggtcaccgaggccgacatcgaacgcgccgcggggttcgcgctcccacaccgcctg
cagtcccgccccttcgaggacgcacccgaccccgaggacgtcgttgacgaccacttcgac
gacgacggcgaccagtccgacgaggaaggcgacgccgagacctcggacgaggcgggcggc
gacgacccggaacccaccgacaacgccgaagccgacgccgagccggacggtgacaccggc
ggggcggaggccccgacgggaggcccggacgacagccagtccgagggcagccaggccccc
gccgactccgaggccggcgacgacccgacggacggcgagcgcggcgacgacgaggacacc
gaagacgccgcgccgctggtgcccggccagccccgcggggacacggtcgaaccaggcacc
ggcgtggccccggacgccgatgcgccggacgccgagcgcgccaccggcgattccgggcgt
gcgtccgccactccgagcccggacgcccggggggcgcgcgtgcgaaccgagcgcgcgaca
cccgccgacgacgtcgacgccgctgcgtcggtccgcgcggccgccgcgcgcggcagtgac
gccgtcgaatcgcgggacctcaggcagtcgatcaacgcggggtcggcgtccgcgctcgtc
gtgttcgcggtggacgccagcgcgtccatgcgggggccgatgcgcgccgcgaaaggcgtc
gcgctcgacctgctccgggacgcctaccagcaccgcgacgagatcgccgtggtcgcgttc
gcgggcgacgacgccgacgtgctggtgccgcccacggacagcgtggcgctggccgcccgc
cacctcaaagacctccccactggcgaccgaacaccgctaccagcgggactacgggccgcc
gacgacgtgctcgcgcgcgcggaccccgacgcgagcgtcgtcgtcgtcgtgaccgacggc
caggcgaacgccactgacacccccacggcggcgacccgaacggccgcatctgcgctcgcc
gagcggggcgcacacgtcgtcgtcgtcgacgccggcgacaacgccagggggctcaccagc
gacatcgtcgacgccgcagacggtgaacgcgtgcccctcgacgcgctcagcgccgaccgc
gtcgaacacgcagtcggccaggcgcgaaaatga

DBGET integrated database retrieval system