KEGG   Halobacterium salinarum: OE3486RHelp
Entry
OE3486R           CDS       T00662                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hsl  Halobacterium salinarum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    OE3486R (speB)
Enzymes [BR:hsl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     OE3486R (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1297296..1298114)
Genome map
AA seq 272 aa AA seqDB search
MFPGASTADESNPGADADYVVVGAPLDVSTSFQPGTRFGPGELRTYAATFEDYHHRTGTH
FSALSVTDYGDVRAWNDVPAYLEYLNGVVTDISWNDATPLLVGGEHTVTVAAVRALNPDV
FVALDAHLDLRAALDGDPLSHSTVTRHALDVADEAIVVGARAGSEEEWERAADSDVTVIE
PSAVADWTPAFGDADVYLSVDIDAADPGYAPGTGTPEPFGMSPRELRAAVRAVAPHAVGF
DVVEVNDRDDGQAPTLGAKLLREFVHTHHADG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgttccctggcgccagcaccgccgacgagtcgaaccccggagccgacgccgactacgtc
gtcgttggggcgcccctcgacgtgtcgacgtcgttccagccgggcacccgtttcggcccc
ggtgaactccggacgtacgccgcgaccttcgaggactaccaccaccggacgggcacgcac
ttctccgccctctcggtcactgactacggcgacgtgcgcgcgtggaacgacgtgccggcg
tacctcgaatacctcaacggcgtcgtcaccgacatctcgtggaacgacgccacgccgctg
ctcgtcggcggcgaacacacggtgaccgtggcggcggttcgcgccctgaacccggacgtg
ttcgtggccctggacgcccacctcgatctgcgcgctgccctcgacggtgatccgctgagc
cactcgacggtgacgcgccacgccctcgacgtggccgacgaagcgatcgtcgtgggcgca
cgcgccggctccgaggaggagtgggagcgcgccgccgactctgacgtgaccgtgatcgag
ccgagcgccgtcgccgactggacgccggcgttcggcgacgcggacgtgtacctgagcgtg
gacatcgacgccgccgatccggggtacgcgccgggcaccgggacgccggagccgttcggg
atgtcgccacgggagctccgggcggccgtgcgcgcagtcgccccgcacgctgtcgggttc
gatgtcgtggaggtcaacgaccgggacgacggccaggcccccaccctcggcgcgaagctg
ctgcgcgagttcgtgcacacgcaccacgccgacgggtaa

DBGET integrated database retrieval system