KEGG   Halobacterium salinarum: OE3606RHelp
Entry
OE3606R           CDS       T00662                                 

Gene name
suk
Definition
sugar kinase (EC:2.7.1.-)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hsl  Halobacterium salinarum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hsl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OE3606R (suk)
Enzymes [BR:hsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     OE3606R (suk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1357101..1357988)
Genome map
AA seq 295 aa AA seqDB search
MSRVVAAGHVNWDVTLRVDALPEPDGEAEIVSQRRSGGGSAANVACALAGFDIDAGLVGS
VGDDEHGLLAQRELQAAGVDLAGLRVVDGLETSVKYLLVDSRGEVMVLGNDGANEAVAPG
DLDPAVVGADCEHVHLTSQRPATAARLTALAREHDATVSFDPGRRLRDRDYGDALARTDI
LFVNDNEAGAVLDDDGGPTAPDSDRVVVVKHGSEGATVHTPSGSVTHPGFAVDPVDTTGA
GDAFAAGFVAVVLDGGDHERALEFGNACGALAAQHEGARTAPTRADAASFLDSQF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgtcgtcgccgccggccacgtcaactgggatgtcacgctccgcgtggatgcg
ctccccgaacccgacggggaagccgagatcgtctcccagcggcgctcgggcggtggcagc
gccgccaacgtcgcgtgcgcgctcgccggcttcgacatcgacgccggcctcgtcgggagc
gtcggcgacgacgaacacggcctgctcgcgcagcgcgaactccaggccgccggcgtcgac
ctcgccggcctgcgcgtcgtcgacggcctcgaaacgagcgtcaaatacctcctggtggac
agccgtggggaggtcatggtgctcggcaacgacggcgcaaacgaggccgtcgcgcccggt
gacctcgaccccgcggtggtcggcgcggactgcgagcacgtccacctcacgagccagcgc
cccgccaccgccgcccgcctcacggccctcgcccgggagcacgacgccaccgtctccttc
gatccggggcgtcggctccgcgaccgcgactacggcgacgcgctcgcccgcaccgacatc
ctgttcgtcaacgacaacgaagccggcgccgtcctcgacgacgacggcggcccgaccgcc
cccgacagcgaccgcgtcgtcgtcgtcaaacacggctccgagggcgcgaccgtccacacc
cccagcgggtcggtcacccaccccgggttcgcggtcgatcccgtggacacgaccggcgca
ggcgacgcgttcgccgccgggttcgtcgccgtggtgcttgacggcggcgaccacgagcgc
gccctggagttcggcaacgcctgcggcgcgctcgccgcccaacacgagggcgcgcgcacc
gcgccgacgcgcgccgacgccgcgtcgtttctcgacagccagttctga

DBGET integrated database retrieval system