KEGG   Halobacterium salinarum: OE3941FHelp
Entry
OE3941F           CDS       T00662                                 

Gene name
thrC3
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hsl  Halobacterium salinarum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hsl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OE3941F (thrC3)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OE3941F (thrC3)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    OE3941F (thrC3)
Enzymes [BR:hsl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     OE3941F (thrC3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1537872..1538963
Genome map
AA seq 363 aa AA seqDB search
MLVCRSCGATYETGPEEPWRCRACEHAVDFAERPRATGDPTAVDPTAGLWAFSEFLPVAA
DDAVSLGEGWTPLVSASEWDAEFKLDYVCPSGSYKDRGAAVLMTRAAALGVDRVVEDSSG
NAGAAVAQYAARAGIDAEIYVPADAPAAKLDAMEAAGATTVPVAGGRRAVTEACVSEAVG
SDAWYASHAWSPSFYAGTATVAYEIAAQRGWRAPDAVVVPVGHGTLLLGAYRGFRALAAG
GWIESMPRLLGVQAAGVEPVAAAVNGSASDEDAVNEAADGIQIRSPARLDQVAAAVAATD
GDVVACDESATTDALASLHEAGLYVEPTSAVAVAGLAAYRARGVVGDSDDVVVALTGSGL
KKP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtgtgccggtcgtgtggcgcgacgtacgagacgggtcccgaggagccgtggcgc
tgccgggcgtgtgagcacgccgttgatttcgccgagcgcccacgggcgaccggggacccg
acggcggtcgatccgacggcggggctgtgggcgttctcggagttcctgccggtggccgcc
gacgatgccgtgtcgctgggggaagggtggacgccgttggtgtcggcgtccgagtgggac
gccgagttcaaactcgattacgtgtgtccgtcgggcagctacaaggaccgcggcgcggcg
gtgctgatgacgcgggcggcggcgctgggtgtggatcgcgtcgtcgaggactcgtcgggg
aacgccggggcggcggtcgcgcagtacgccgcgcgggcgggcatcgacgcggagatctac
gtgccagcggacgccccggcggcgaagctggacgcgatggaggccgccggcgcgacgacc
gtgccggtggcgggcggacggcgtgcggtgaccgaggcgtgcgtcagcgaggccgtcggg
agcgacgcgtggtacgccagccacgcgtggtcgccgtcgttctacgccgggacggcgacg
gtcgcctacgagatcgccgcccagcgggggtggcgtgcgccggacgcggtggtggtgccc
gtcggccacggcacgctgctgttgggcgcgtaccgggggtttcgggcgctcgccgcgggc
ggctggatcgaatcgatgccacgactgctgggggtgcaggcggcgggcgtggagccggtc
gccgcggcggtcaacgggtcggcatcggacgaagacgcggtcaacgaggcggccgacggg
attcagatccggtcgccggcccgcctggatcaggtggcggctgcggtggcggcgaccgac
ggcgacgtggtggcgtgtgacgagtcagcgaccacggacgcgctggcgtcgctgcacgag
gccgggctgtacgtcgagccgacgagtgcggtggctgtcgcggggcttgcggcgtaccga
gcccgcggcgtggtcggtgacagcgatgacgtggtcgttgcgttgaccggcagcggcctg
aagaagccctaa

DBGET integrated database retrieval system