KEGG   Halobacterium salinarum: OE4094FHelp
Entry
OE4094F           CDS       T00662                                 

Gene name
pmm1
Definition
phosphohexomutase (phosphoglucomutase,phosphomannomutase) (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hsl  Halobacterium salinarum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hsl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OE4094F (pmm1)
   00030 Pentose phosphate pathway
    OE4094F (pmm1)
   00051 Fructose and mannose metabolism
    OE4094F (pmm1)
   00052 Galactose metabolism
    OE4094F (pmm1)
   00500 Starch and sucrose metabolism
    OE4094F (pmm1)
   00520 Amino sugar and nucleotide sugar metabolism
    OE4094F (pmm1)
  Nucleotide metabolism
   00230 Purine metabolism
    OE4094F (pmm1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    OE4094F (pmm1)
Enzymes [BR:hsl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     OE4094F (pmm1)
    5.4.2.8  phosphomannomutase
     OE4094F (pmm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1623560..1624927
Genome map
AA seq 455 aa AA seqDB search
MNVFGSSGTRGVANEELTPGFVLRVAKAAGSVWRADRVAVARDTRTTGRMLENAAVAGLQ
SIGVDVDRLGVVPTPATQAYAERAGVPAVMVTASHNPSQYNGVKLVGSDGVELAVADLER
VERAFTTEQFDNAAWDGVGADREVASAGRDYRAQLSDAVDRAAIAAADLTVALDPGHGAG
ALTSPTFYRELGCDVVTVNAQPDGHFPGREPEPVREHLGDLGALVRAADADVGIAHDGDA
DRAIFVDETGEYIEGDATLAALAEAELDAGDTTVSAVNVSQRLVDVCDRTGATLELTPIG
STQIMTRIRELEAEGDHVPVAGEGNGGIIFPEYRMTRDGAYTGARFLELLADGTPASEVV
APYDDYHNVRVNVDYDTEAQRGALLDAAEARALDADADRTTIDGYRLDYGDAWVLVRPSG
TEPVVRIYAESTDHERAESLAEAFAADLRAARADA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcttcgggtcgagcggaacgcggggcgtggccaacgaggagctcacaccgggg
ttcgtgttgcgcgtcgcgaaggcggccggctcggtgtggcgcgccgaccgcgtcgcggtc
gcacgggacacccgaaccaccggccgcatgctcgaaaacgcggccgtcgcgggcctccag
agcatcggcgtggacgtcgaccggctcggggtggttccgacgccggccacgcaagcgtac
gcggagcgcgccggcgtcccggcggtgatggtgaccgcgagtcacaaccccagccagtac
aacggcgtcaagctcgtcggcagcgacggcgtcgagctggcggttgccgacctggagcgc
gtggagcgcgcgttcaccaccgagcagttcgacaacgccgcctgggacggtgtgggagcc
gaccgggaggtggcgtccgcgggccgcgactaccgcgcacagctgtccgacgccgtcgac
cgggcggcgatcgcggccgccgacctgacggtcgccctggacccgggccacggcgcgggc
gcgctcaccagcccgacgttctaccgcgagctcgggtgtgacgtcgtcaccgtgaacgcc
cagccggacggccacttccccggccgggagcccgagccggtgcgcgaacacctcggcgac
ctcggcgcactcgtgcgcgcggccgacgccgacgtggggatcgcccacgacggcgacgcc
gaccgtgccatcttcgtcgacgagaccggcgagtacatcgagggcgacgccacgctcgcg
gcgcttgcggaggccgagctcgacgccggcgacaccacggtgtccgcggtgaacgtcagc
cagcgcctcgtggacgtctgcgaccgcactggagcgacgcttgagctcacgcccatcggc
tccacgcagatcatgacccggatccgcgagctggaagccgagggcgaccacgtcccggtg
gccggcgagggtaacggcgggatcatcttcccggagtaccgcatgacccgcgacggcgcg
tacactggcgcacggttcctcgaactgctggccgacggcacgcccgcaagcgaggtcgtc
gcgccgtacgacgactaccacaacgtccgcgtgaacgtcgactacgacacggaagcacaa
cggggggcgctcctcgacgcggcggaggcgcgcgcgctggacgcggacgccgaccgcacc
accatcgacggctaccggctggactacggcgacgcctgggtgctcgtgcggccgtcgggc
acggagccggtcgtccgcatctacgcggagtccaccgaccacgagcgggccgaatccctc
gcggaggcgttcgccgcggatctgcgcgcggcgcgggccgacgcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system