KEGG   Halobacterium salinarum R1: OE4281FHelp
Entry
OE4281F           CDS       T00662                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hsl  Halobacterium salinarum R1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hsl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1726937..1727641
Genome map
AA seq 234 aa AA seqDB search
MFRPDDDRIADAVALLDDLGAVPVPDPMLAVDPTGAIPRGDGAVVVVTSKTGVELAADSG
WTPGGGRLAAIGPATADACREAGWTVDVVPEEYTSAGLVAALDGDIDGARVEVARSDHGS
AVLTDGLAEAGAYVHETVLYALTRPAGAGDSTEIAAAGDLDAALFTSSLTVEHWLAAARE
RGIESAAREGLADATVGAIGPPTAETAADHGISVDVVPDDAGFEALARATIEDA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
gtgttccggcccgacgacgaccgcatcgcggacgccgtcgcgctgctcgacgacctgggc
gctgtgccggttccggacccgatgctggccgtcgacccgaccggggctatcccccgcggg
gacggcgctgtcgtcgtcgtcacgagcaagactggcgtcgaactcgccgccgacagcggg
tggacgccgggcggcgggcggctggcagccatcgggccggcgaccgccgacgcctgccgc
gaggcgggctggacggtcgacgtggtccccgaggagtacaccagcgccgggctcgtcgcc
gcgttggacggcgacatcgacggcgcgcgcgtcgaggtggcgcgctcggaccacggctcg
gcggtgctcactgacgggctagccgaggccggcgcgtacgtccacgaaacggtgctgtac
gcgctcacgcgcccggcaggcgcgggtgactccacggaaatcgccgccgccggcgatctc
gacgcggcgctgttcacgtcctcgctgaccgtcgagcactggctggcggccgcccgcgag
cgcggcatcgagtcggccgcccgcgaggggctcgccgacgccacggtgggtgccatcggc
ccgccgacggccgagacggccgccgaccacggcatcagcgtcgacgtggtgcccgacgac
gctggcttcgaggcgctggcgcgggccaccatcgaggacgcgtag

DBGET integrated database retrieval system