KEGG   Halobacterium salinarum: OE5192RHelp
Entry
OE5192R           CDS       T00662                                 

Gene name
aph
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
hsl  Halobacterium salinarum
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:hsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OE5192R (aph)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    OE5192R (aph)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OE5192R (aph)
Enzymes [BR:hsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     OE5192R (aph)
Exosome [BR:hsl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OE5192R (aph)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
PHS3:complement(116047..117468)
Genome map
AA seq 473 aa AA seqDB search
MPTPHTTESPSVDRRTFLAGLSGAVAGGAVASQFQTTARAQATASPAANAIAYIVDGMGQ
TQISAARYLNAYKTAPERFPLNVSPAETPTGFDAFSSRGSMTTFPDDPYETTTDSAAAAT
AFASGVKTYNGAIGGVQTSGGGFQRVDTVLERASAQGYATGLITTTEATHATPAAFAAHV
EDRGNQTEIARQYIEETQPDVILGGQRRDFEADASNGGTLVDAARDNGYTIAETAAELDA
VDDPPVLGLFSQESHLDYYLDRKNDPENTQPNLDAMVDAGVDLLSSAGDPDKGFFLLVES
GRVDHAGHANYPAQVAEQYEATQVAGQLVEYAETTAEPTFLVSTGDHECGGLTLGRDSPY
EVEYDVLAAQKATTSRLRDLLAGVRSADELESIVAAHTGITALTDREVAKLRDAPGSIST
ILAERAGIAFTTDGHTGTDVPVFAHGPNAARFDAARDNTAVADALAAALGVSL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaccgcacaccacagagtcacccagtgtcgatcggcgcacgttcctggcgggc
ctcagcggggccgtcgccgggggcgcagtcgcgtcacagttccagacaacggcgcgcgca
caggccacggcgtccccggctgcgaacgccatcgcgtacatcgtcgatgggatggggcag
acacagatctccgccgcgcgctacctcaacgcctacaagacagcgcccgagcgcttcccg
ctgaacgtgagtccggccgagacgccgaccgggttcgacgcgttctcgtcccgcggttcg
atgaccacgttccccgatgacccctacgagacgaccaccgactcggcggccgccgcaacc
gcgttcgccagcggcgtcaaaacctacaacggagcgatcggtggcgtccaaacctcaggc
ggcgggtttcagcgcgtcgatacggtcctcgaacgggccagcgcccaggggtacgcgacc
ggcctcatcacgacgaccgaggcgacacacgccacacccgcagcgttcgcggcacacgtc
gaggatcgcggcaaccagaccgagatcgcgcgccagtacatcgaagagacccagccggac
gtgattctcggggggcagcgccgcgacttcgaggcggacgcgtccaacggcggcacgctg
gtggatgcggccagggacaacggctacacgatcgccgaaacggcggctgaactggacgcg
gtcgacgacccacccgtactcgggctgttcagccaggagagccacctcgactactacctg
gaccgcaaaaacgaccccgagaacacacaacccaacctcgatgcgatggtcgacgcgggg
gttgacctgctctcgtcggccggcgaccccgacaaggggtttttcctgctggtggagtcc
gggcgcgtcgatcacgccggccacgcgaactaccccgcccaggtcgccgaacagtacgaa
gccacgcaggtggcgggccagttggtggagtacgccgagacgaccgccgagccgacgttc
ctcgtttcgaccggcgaccacgagtgtggcggtctcacgctgggtcgcgactcgccctac
gaggtcgaatacgacgtgctcgccgcgcagaaagcgaccaccagccggcttcgggatctc
ctcgccggggtccggagcgctgacgaactggagtcgatcgtcgccgctcacacgggcatc
accgcactgaccgaccgagaggtggcaaagctccgcgacgctccgggttcgatcagcacg
attctcgcggagcgagccgggatcgcgttcaccaccgacggacacacgggcaccgacgtg
ccggtgttcgcacacggcccgaacgcggcgcggttcgacgccgcacgcgacaacactgcg
gtcgccgacgcgctcgctgcggcgctcggtgtgtccctgtaa

DBGET integrated database retrieval system