KEGG   Haemophilus somnus 2336: HSM_0057Help
Entry
HSM_0057          CDS       T00673                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
hsm  Haemophilus somnus 2336
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HSM_0057
   00670 One carbon pool by folate
    HSM_0057
Enzymes [BR:hsm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     HSM_0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(51075..51560)
Genome map
AA seq 161 aa AA seqDB search
MKLSIIVAMTKNHVIGKNNQMPWHLPADLAWFRQNTGGKPIIMGRKTFESIGRPLPNRTN
IVLSRSPYEHDGIIWKDNLQSAVDFVRENHHEIMLIGGGELFKQYLPQANKLYLTEIQTE
LEGDTFFPEFNWQEWQIEFEQQRPADEKNPYACRFLILNRK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaagtataattgttgctatgacaaaaaatcatgtgattggcaaaaataatcaa
atgccttggcatttgccggctgatcttgcttggtttcgtcaaaatactggcggaaaaccc
attattatggggcgaaaaacctttgaaagtatcggtcgtcccttaccgaatagaaccaat
attgtactttctcgttcgccttatgaacacgatggcattatttggaaagacaatctacaa
agtgcggtagattttgtgcgagaaaatcatcatgaaattatgttgattggcgggggcgaa
ttatttaagcaataccttcctcaagcaaataaattatatttaacggaaattcaaacagaa
cttgagggagatactttctttcctgaatttaattggcaagaatggcagattgaatttgag
caacaacgtccggcagatgagaaaaatccttatgcttgtcgttttctaattttaaacaga
aagtaa

DBGET integrated database retrieval system