KEGG   Haemophilus somnus 2336: HSM_0060Help
Entry
HSM_0060          CDS       T00673                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
hsm  Haemophilus somnus 2336
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HSM_0060
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HSM_0060
Enzymes [BR:hsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HSM_0060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
53026..54138
Genome map
AA seq 370 aa AA seqDB search
METQKTNKTIVVKFGTSTLTQGSSKLNRPHMMEIVRQITQLHRAGFRIIIVTSGAMAAGR
HYLNHPQLPPTIASKQLLAAVGQSQLIQTWEQLFAIYDIHIGQILLTRADIEDRERFMNA
RDTLHALLDNRIIPVINENDAVATAEIKVGDNDNLSALVAILAQAEQLYLLTDQRGLFDS
DPRKNPQAKLISIVDKITDHIRSIAGGSGTTLGTGGMTTKISAADIATRSGVETIIAPGN
LENVIVNLAYGKDIGTKFVVQTDRLESRKQWIFAAPVAGIVTIDEGAESAVLIQHKSLLP
AGIISVEGCFSRGEVVKICGSNGKKIALGVPRYNSDSLIQIKGKKSQDIEQILGYEYGSV
AIHRDDMVVY
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacaaaaaacaaataaaaccattgtggtaaaatttggtaccagcaccttaacg
caaggttcatcaaaattaaatcgccctcacatgatggaaattgtgcgtcaaatcacacag
ttgcatcgagcaggctttcgtataattattgttacctccggagcgatggcagcggggcga
cattatctcaatcatccgcaacttcctccaacaattgcctcaaagcaattactagcagca
gtaggacaaagtcaactcattcaaacgtgggaacaacttttcgctatttatgatattcat
attgggcaaattctgttaactcgagcggacattgaagatcgtgaacgttttatgaacgca
agagatacgttacatgctttattagataaccgaattattccggtaattaatgaaaatgat
gcggttgcaaccgctgaaattaaagtgggggataatgacaacctttctgcattagtggct
attttggcacaagcagaacaactctacttgctaacagatcaacgtggattatttgatagt
gatccaagaaaaaatcctcaagcaaaactgatttccatagtcgataaaattactgatcat
atccgctctattgccggaggaagtgggacaacgttagggacgggaggaatgacaacaaaa
attagtgctgctgacatagcgactcgttccggtgttgaaaccattattgcaccgggtaat
cttgaaaatgtcattgtcaatttggcttatggaaaagacatcggcacaaaatttgttgtg
cagacagatcgcttggaaagccgtaaacagtggatctttgctgcaccggttgcaggtata
gtaactattgatgagggagcggaaagtgcggtattgattcagcataaatctctattacct
gcaggtattatcagtgttgaaggatgtttttctcgtggtgaagttgttaaaatttgtggt
tcgaacggtaaaaaaattgctttgggcgtacctcgctataacagcgattctctcatacaa
ataaaaggaaaaaaatcgcaagatattgaacagatcctcggttatgaatatggttctgtt
gctattcatcgtgatgatatggtcgtttattaa

DBGET integrated database retrieval system