KEGG   Haemophilus somnus 2336: HSM_0080Help
Entry
HSM_0080          CDS       T00673                                 

Definition
polar amino acid ABC transporter inner membrane subunit
Orthology
K10009  
cystine transport system permease protein
Organism
hsm  Haemophilus somnus 2336
Pathway
ABC transporters
Module
Cystine transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:hsm02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(90204..90935)
Genome map
AA seq 243 aa AA seqDB search
MVEISVLNNFLASLPFMTEARAELVINGFFPMVKAAVLVSIPLAIVSFILGMVIAIAVAL
IRVSPSHSIIHRLFLFITKIYISIIRGTPMLVQISIVFYGLPALGIFIDPIPAAIIGFSL
NVGAYASETVRAAIQSVPKGQWEAGYTIGMTYMQTFRRIIVPQAFRVAVPPLSNTFISLF
KDTSLASVVTVTEMFRVAQQVANMSYDFLPVYIEAALIYWCFCFILFLWQARIEKKLARY
VTR
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
ttggtagagatatcagtgttaaataatttccttgcctcattgccttttatgactgaggca
agagcagaattagtcatcaatggattttttcccatggtcaaagcggcggtattagtttca
ataccgcttgctatcgtatcatttatattgggaatggttattgcgattgctgttgcgtta
attcgagtgagtccaagccatagcattatccatcgcctctttttatttataacaaaaatt
tatatttcaattattcgtgggacaccaatgctagtgcaaatatccatcgttttttatgga
ttacctgcactggggatttttattgatcctattcctgccgcaattatcggtttctcatta
aatgtcggtgcttatgcttctgaaacggtacgagcggcgatacaatccgtccccaaagga
caatgggaagccggttacacaatcggcatgacttatatgcaaactttccgccgaattatt
gtaccgcaagcatttcgtgttgccgttccacctctgagtaatacatttatcagtttattc
aaagacacttctttagcttcggtagtaacagtaacggaaatgttccgagtggcacaacaa
gtagcaaatatgtcttacgatttcttacccgtttatattgaggcagccctgatttattgg
tgtttctgttttatcttgttcttatggcaagctcgcatagaaaaaaaacttgctcgttat
gttactcgctaa

DBGET integrated database retrieval system