KEGG   Haemophilus somnus 2336: HSM_0093Help
Entry
HSM_0093          CDS       T00673                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hsm  Haemophilus somnus 2336
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HSM_0093
Enzymes [BR:hsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HSM_0093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
102345..103298
Genome map
AA seq 317 aa AA seqDB search
MSKTLTVLGSINADHVISVPHFAKPGETLSGKQYHIAYGGKGANQAVAAARLADFSQGAT
VNFVGCIGSDDIGRAMKKAFAQDGINVATITEIPNEMTGIAMIQVADSGENSIVISAGAN
AYLTPEIVDKFATEIERADYLLMQLETPLNAILEAAKLAKKHGATVVLNPAPANQLPDEL
LSLLDMITPNETETEILTGVKVTDEQSAAKAASVLHQKGVATVLITLGSKGVYVSRKSST
QELGQNKVIAGFRVNAVDTTAAGDTFNGAFLTALLENKSLDEAIRFAHAAAAISVTRQGA
QPSIPTRRETLDFLAQH
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaactcttactgttctcggtagtattaatgcggatcatgttatttctgtaccg
cactttgccaaaccgggcgaaacactaagtggtaaacaatatcatattgcttatggcgga
aaaggtgcaaatcaagctgtggcagcagcaagattagcggattttagccaaggtgcaaca
gtgaattttgttggttgtattggtagtgatgatattgggcgagcgatgaaaaaagcgttt
gcacaagatggtattaatgttgcgacaattactgaaattcctaatgaaatgactggaatt
gcaatgattcaagtggctgatagcggagaaaacagtattgtcatttctgccggtgcaaat
gcatatttaacgcctgagattgtagataaatttgcgacagaaattgagcgggcggattat
ttactcatgcaattggaaacaccgttgaacgcaattttggaagcagctaaattagctaag
aaacatggtgcgacagtcgtattaaatcctgctcctgcgaaccaattacctgatgaattg
ctcagtttattagatatgattacgccgaatgaaacagaaacggaaattttaaccggtgtg
aaggtaaccgacgagcaaagtgcggcgaaagcagcgagtgttttgcatcaaaaaggtgtt
gctactgtgttgattacgttaggttcaaaaggtgtttatgtgagtcggaaatcttcgaca
caagaactggggcagaataaggttatagccggattcagagtaaatgctgtagatacaact
gcagccggtgatacgtttaatggggcatttttgaccgcacttttagaaaataaatctctt
gacgaagcgattcgttttgcacatgcggcggcagcgattagtgtgacgcgtcaaggggca
caaccttccattccaactcgtcgagaaacattagactttttggcacaacattaa

DBGET integrated database retrieval system