KEGG   Haemophilus somnus 2336: HSM_0142Help
Entry
HSM_0142          CDS       T00673                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hsm  Haemophilus somnus 2336
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hsm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
152288..152902
Genome map
AA seq 204 aa AA seqDB search
MIGRVTGILVEKQAPEILLDVQGVGYELLLPMTSFYNLPEVGQETTLFTHFVVREDAHLL
FGFSHKQDRSLFRELIKTNGVGPKLALAILSAMSVNEFVYAIEQEELSKLVKIPGVGKKT
AERLLVELKGKFKGLQQTDFFIKSSHLPGIKCSKLDQSLQLDEAVSALIALGYKPIEAEK
MVKKVLKADLTSEQLIREALKAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgattgggcgtgtaacaggaatactggttgaaaaacaagctccggaaattttactggat
gttcaaggtgttgggtatgagttacttttacccatgacaagtttttataatttgccggaa
gttgggcaggaaactacgttgtttacgcattttgtggtgcgtgaagatgctcatttgtta
tttggatttagccataaacaagaccgctctttatttcgtgaattgattaaaaccaatgga
gttggaccaaaattagctttagctatcctgtctgcgatgtcagtgaatgaatttgtgtat
gcgattgaacaagaagaattatctaaattagtcaaaattcccggagtaggaaaaaaaact
gctgaacgtttattggtggagctaaaaggtaaatttaaaggcttacaacaaacagatttc
tttattaaaagctctcatttacctggaattaaatgctcaaaactggatcaaagtttgcag
ttggatgaagcagtttctgctttaattgcgttaggatataagcctattgaagcagagaaa
atggttaaaaaagtgttaaaagcagatttaactagtgaacagcttattcgagaggctttg
aaagccgcattataa

DBGET integrated database retrieval system