KEGG   Haemophilus somnus 2336: HSM_0411Help
Entry
HSM_0411          CDS       T00673                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hsm  Haemophilus somnus 2336
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hsm00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:hsm00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(475909..477669)
Genome map
AA seq 586 aa AA seqDB search
MSVDLTKKPYYLKDEDIQWVKNTIANMTLEEKIGQLFVNMGSSRSEEYLTDVLNRYHIGA
VRYNPGPAEEVYDQNYILQTKSKIPLLIAANTEAGGNGACSDGTEIGLQVKIGATDDAKY
AYEMGRVAGIEAAAIGCNWSFAPIVDISYNWRNPIISNRVFGSNPEKVLEMSLAYMKGIQ
ESGIAPAAKHFPGDGVDERDQHLSFSVNSFSCEEWDKTFGKVYQGLIDAGLPSLMAGHIH
LPAYEQHFNPNLAYEDCLPATLSKPILTDLLRGKLGFNGVVVTDASHMVAMTSAMKRSEM
LPTAIAAGCDLFLFFNDPDEDFGYMMEGYKNGIITEERLHDALTRILGLKAKLGLHNRPR
ETLLEPKEQALAKIGLPEHKAIFRDVADKAITLVKHKQDIFPINVERFPRILLVNVKGTD
GGFGKMVAGSQRSATEILKEKLEEKGFTVSIYTSPMDNILKMSDEEQVKTIRNEYSQKRP
ITTLTDHYDLIINVANVQMSTVQRIVWQATKGTPDIPFYVHEVPTIFVSVQCPFHLVDVP
QVKTYINAYDGKEPTIELLVEKLMGNSEFKGISPVDAFCGYKDTRI
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgatttaacgaaaaaaccttattacttaaaagatgaagatattcaatgggta
aaaaacactatagccaatatgacgttggaagaaaaaatcggtcagctttttgtgaatatg
ggttcaagcagatccgaggaatatctcactgatgttttaaaccgttaccatattggtgcg
gtacgttataatcccggtcctgctgaggaggtttatgaccaaaactatattctacaaact
aaaagtaaaattcctctcttaattgcagcgaatacagaagctggtggtaatggtgcttgc
agtgatggaacagaaattggtttacaagtcaaaatcggtgcaaccgatgatgctaaatat
gcttatgaaatggggcgtgtagctggtattgaagcagcagctatcggttgtaactggagt
tttgctcctatcgttgatattagttataactggcgaaacccaattatttctaatcgagta
tttggttcaaatccagagaaagtactagaaatgtccttggcttatatgaaaggtattcaa
gaaagtggtattgccccggctgcaaaacatttccctggtgatggagtggatgaaagagat
cagcatctttcttttagtgtaaacagttttagttgcgaagagtgggacaaaactttcggc
aaagtttatcaaggcttaattgatgccggtttaccatcgttgatggcaggtcatatacac
ttacctgcttacgagcagcatttcaatccaaatttagcttatgaggactgcctaccagcg
acactttcaaaaccaattttaacagacttattacgaggtaaattaggtttcaacggtgtt
gttgttactgatgccagccatatggtagcaatgacttcagcaatgaagcgtagcgaaatg
ctaccgactgctatcgctgcaggttgtgatttattccttttctttaacgatcctgatgaa
gatttcggttatatgatggaaggttataaaaacggcattattaccgaagaacgccttcat
gatgcccttactcgtattctagggttaaaagcaaaattaggcttacacaatcgcccaaga
gaaacattgcttgaaccaaaagaacaagcattagcaaaaataggacttccagaacataaa
gcaattttccgtgatgttgcagataaagcaattaccttagttaaacataaacaagatatt
ttcccaattaatgttgaacgtttccctagaatcttacttgtaaatgttaaaggtacagat
ggtggcttcggtaaaatggttgcaggtagtcaacgcagtgcaacagaaatcttaaaagaa
aaactggaagaaaaaggatttacagtttctatttatacatcaccgatggataatattctc
aagatgtcggacgaagaacaggtcaaaactattcgtaatgaatactcccaaaaacgccca
attacgacattaacggatcattatgatctgattatcaatgttgcgaatgtgcaaatgagt
acagttcaacgtatcgtatggcaagcgaccaaaggaacgcctgatattccattctatgta
catgaagtacctacaattttcgtttccgttcaatgcccattccatttagttgatgttcct
caggtaaaaacttacatcaatgcctatgacggcaaagaaccaaccatagaattactggta
gaaaaattaatgggtaattccgagtttaaaggtattagcccagttgatgctttctgtggt
tataaagacacccgtatttaa

DBGET integrated database retrieval system