KEGG   Haemophilus somnus 2336: HSM_0420Help
Entry
HSM_0420          CDS       T00673                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hsm  Haemophilus somnus 2336
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HSM_0420 (tpiA)
   01230 Biosynthesis of amino acids
    HSM_0420 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HSM_0420 (tpiA)
   00051 Fructose and mannose metabolism
    HSM_0420 (tpiA)
   00562 Inositol phosphate metabolism
    HSM_0420 (tpiA)
Enzymes [BR:hsm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HSM_0420 (tpiA)
Exosome [BR:hsm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HSM_0420 (tpiA)
  Exosomal proteins of bladder cancer cells
   HSM_0420 (tpiA)
  Exosomal proteins of melanoma cells
   HSM_0420 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
485192..485959
Genome map
AA seq 255 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELITGLKDELNAVSGCDVAIAPPVMYLAEAEAALVSSDI
ALGTQNVDLNKQGAFTGDISTEMLKDFGVKYVIIGHSERRQYHHESDEFIAKKFGVLKDA
GLVPVLCIGESEAENEAGKTEEVCARQIDAVMNTLGVEAFNGAVIAYEPIWAIGTGKSAT
PAQAQAVHAFIRGHIAKQSQAVAERVIIQYGGSINDANAAELFTQPDIDGALVGGASLKA
SAFAVIVKAAAKAKN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcgtcctttagtcatgggtaactggaaattaaatggtagtaaagcctttaca
aaagaacttattaccggtttaaaagatgaacttaatgcggtgtcaggctgtgatgtggca
attgcaccgcctgtcatgtatttagcggaagctgaagctgcactggtcagcagtgatatt
gctttaggtactcaaaatgttgatttaaacaaacaaggtgcatttaccggtgatatttca
acagaaatgttaaaagactttggtgtaaaatatgtcattatcggtcattctgagcgacgt
caatatcatcatgaaagtgatgaatttattgcgaaaaaatttggtgtgttaaaagatgct
ggtttagttcctgtattatgtatcggtgaaagcgaagctgaaaatgaagcaggcaaaacg
gaagaggtttgtgcacgtcaaattgatgcggtgatgaatacactaggtgttgaagcattt
aacggtgcagtaatcgcttatgaaccgatttgggctatcggtacaggtaaatcggcgact
ccagctcaagcacaagcagtacatgcctttattcgaggacatattgcaaaacaaagccaa
gccgttgccgaacgggtaattattcaatatggcggttccatcaatgatgcaaatgcagca
gaattgtttactcagcctgatattgatggtgcattagttggtggtgcatcgttaaaagcg
tcagcgttcgctgtcattgttaaagcggcggcgaaagcaaaaaactga

DBGET integrated database retrieval system