KEGG   Haemophilus somnus 2336: HSM_0526Help
Entry
HSM_0526          CDS       T00673                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hsm  Haemophilus somnus 2336
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
603776..604471
Genome map
AA seq 231 aa AA seqDB search
MKKFLMVSLAMLMSTFVKADNNVTIRKNLQKLGMTDVEIMESPIKNIKSVLTREGTLYVS
EDGKYVLHGALYEITDKGIVNLTTKSLLVKLNNLKNEMIVYPAKKEKYVITVFMDITCHY
CHLLHQKIKEYNELGITVRYLAFPRAGLNSNTAKQMEAIWISRDPVFALDEAEKGNLPKE
LKIPNMIQKHYELGIQFGVSGTPSIITESGEVIGGYVEPKKLLQVLEDIRE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttttaatggtaagtttagccatgttgatgtcaacttttgtaaaggcagat
aataatgtcacaattcgcaaaaatttacaaaaattaggtatgactgatgtagaaattatg
gagtctcccattaaaaatataaagagtgttttgacccgtgaaggtactctgtatgtttcg
gaagatggtaaatatgttttacatggtgctttgtatgaaattactgacaaaggtattgtg
aatttaacgacaaagtctttattggtaaaactgaataacttaaaaaatgagatgatagtt
tatccagcgaagaaggaaaaatatgttattaccgtattcatggacattacttgtcattat
tgtcatttattacatcaaaaaattaaagaatataatgagttaggtattactgttcgttat
ttagcttttccacgtgccggtctaaatagcaatacagcaaaacaaatggaggcgatttgg
atatctcgagatcctgttttcgctttagatgaagcagaaaagggcaatttaccgaaagag
ctgaaaattccaaatatgattcagaaacattatgagcttggtattcaatttggagttagt
ggcacaccaagtattataactgaaagcggcgaagtgattggcggttatgtagagcctaaa
aaattattgcaagtattagaagatattcgtgaataa

DBGET integrated database retrieval system