KEGG   Haemophilus somnus 2336: HSM_0546Help
Entry
HSM_0546          CDS       T00673                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
hsm  Haemophilus somnus 2336
Pathway
hsm00230  Purine metabolism
hsm01100  Metabolic pathways
Module
hsm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HSM_0546
Enzymes [BR:hsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HSM_0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase MMR_HSR1 ABC_tran AAA_16 AAA_22 EFP AAA_23 cobW AAA_29
Motif
Other DBs
NCBI-ProteinID: ACA32196
JGI: HSM0546
UniProt: B0URY9
Position
623124..623750
Genome map
AA seq 208 aa AA seqDB search
MCRGNLYIISAPSGAGKSSLISALLERDKNDSMTVSISHTTRSPRPGEIDGVHYHFVSHE
KFEQLILENSFLEYAKVFGGNYYGTSLLNIEKNLAAGIDVFLDIDWQGARQIREKRPDVK
SIFILPPSISALEKRLIGRGQDSQDIIAKRMEKAADEISHYDEYDYVIINADFDQALVDL
EHILRAERLTVNYQKTQNAALIHQLLVK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaggggaaatttatatattatttctgccccaagcggagcagggaaatcttctttg
atttcagcattattggaacgggataaaaacgatagtatgacggtgtccatatcacataca
acaagatccccaagaccgggtgaaattgatggggtgcattatcactttgtttcacatgaa
aaatttgaacagcttattttagaaaactcatttttagaatatgcgaaagtattcggtggg
aattattatggtacgtcattactgaatattgagaaaaatttagcggcaggtatagatgta
ttcttggatattgattggcagggagcaagacaaattcgagaaaaacgtcctgatgttaaa
agtatttttattttgcctccttctatttctgctttagagaagcgtttgattgggcgtggt
caagatagtcaagacattattgcaaagagaatggaaaaggcagcggatgaaatctcccat
tatgatgaatatgattatgtcattattaatgctgattttgatcaagcattagtagattta
gaacatattttgcgagctgaacgattgactgtaaattatcaaaaaacgcaaaatgcggct
ttaattcatcaattactagtaaaataa

DBGET integrated database retrieval system