KEGG   Haemophilus somnus 2336: HSM_0623Help
Entry
HSM_0623          CDS       T00673                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
hsm  Haemophilus somnus 2336
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HSM_0623 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HSM_0623 (murE)
Enzymes [BR:hsm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     HSM_0623 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
722152..723639
Genome map
AA seq 495 aa AA seqDB search
MKKLTALWDIDEQLDSVHRDIELQEMILDSRLAKTGCLFVAIKGHRVDGREFIMQAIQNG
ASAVLFETDLVEQHLTVSFEQNIPLIAYYELSKHLSHIADRFYSSPSQRLTLVGVTGTNG
KTTIAQLLAQWTQILGHTSAVMGTIGNGLFGQIKEASNTTGSAIEIQSSLDKFIRQGADF
AAIEVSSHGLVQHRVEALTFRAGIFTNLSRDHLDYHHTMENYAQAKKRLFSELNCQHKIL
NVDDEIGATWLIELSKDDPDVVAVSCRADYQPDTKNWLKATALSFHSKGTTIEFASSWGN
GILSSPLIGGFNVSNLLLVLATLLSLGYDIDKLLATVRQLTGVCGRMEMLSAKHKATVIV
DYAHTPDALENALQSAAVHCQGKLWCIFGCGGDRDRGKRPLMAAIAEKFADSVIVTDDNP
RTENPEQIMQDILTGFQQSSAVQIIHQREQAIKTALQSAVENDVVLIAGKGHENYQIIGT
TKYHFSDQEIVKKYF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaaccgcactttgggatattgatgaacaattagatagcgttcatagagat
attgaacttcaagaaatgattttagacagccgtttagctaagaccggctgtctttttgtt
gcgattaaaggacatcgtgttgacggtcgagaatttattatgcaagccattcaaaatgga
gcaagtgcggtgctgtttgaaactgatctagtggagcagcatttgacagtaagctttgag
caaaatattccgcttattgcgtattatgaactgtcaaaacatctttctcatattgcagat
agattttattcatctccttcacaacgtttaacccttgttggtgtaacgggaaccaatggt
aaaacaaccatagctcagttacttgcacagtggacacaaattttagggcatacaagtgcg
gtcatggggacgattggtaatggtttatttgggcaaataaaagaagcttcaaatacaacg
ggatcggcaatagaaatacaatcctcgttagataaatttattcggcaaggtgctgatttt
gctgcgattgaagtgtcttctcacgggttagtgcagcatagagttgaggcactgactttt
cgtgcaggcatttttaccaacctaagccgtgatcatcttgattatcatcataccatggaa
aattacgcacaagcgaagaaacgtttgtttagtgaactgaattgtcaacataaaatttta
aatgttgatgatgaaatcggggcaacatggttgattgaattaagtaaagatgatcctgat
gtggttgcagtaagttgccgtgcggattatcagcccgatacaaaaaattggctaaaagca
accgcacttagttttcacagcaaaggcacaacgattgaatttgcctcaagctggggaaat
gggatcttaagtagtccattaattgggggcttcaatgtgagtaatttattacttgtttta
gccacactcttatcgcttgggtatgacatagataaattacttgctacagtacggcaatta
accggtgtttgcgggcgaatggaaatgttgagtgcaaaacataaggctaccgtgattgtt
gattatgcacatacaccggacgctttagagaacgctttgcaatctgctgcagttcattgt
cagggaaaactttggtgtattttcggttgtggcggtgatcgtgatagaggtaaacgtcca
ttaatggcagctattgccgaaaaatttgctgatagtgtgattgttactgatgataatcct
cgaacagagaatcctgaacaaattatgcaagatattttgacaggttttcagcaatcaagt
gcggtgcagattattcatcagcgtgagcaagcaattaaaacagcgttacaaagtgcggta
gaaaatgatgttgttttgattgctggaaaaggtcatgagaattatcaaattattggaaca
actaaataccatttttcggatcaggaaattgtaaaaaagtatttttaa

DBGET integrated database retrieval system