KEGG   Haemophilus somnus 2336: HSM_0811Help
Entry
HSM_0811          CDS       T00673                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
hsm  Haemophilus somnus 2336
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    HSM_0811
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    HSM_0811
Enzymes [BR:hsm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     HSM_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
929544..930302
Genome map
AA seq 252 aa AA seqDB search
MVKKVALITGAASGIGLAICESLATEDLNIVMVDVNKETLKEHSTRLGTAYIQADLSKRE
GCKTAVDFAAEKFGSVDILVNVAGIQNVAAIENFSEDKWDFMINLMLTAPFLLTKYSWKY
MKANKWGRIINLNSIHGLVASDFKSAYVSAKHGLSGLTKVAALEGGEFGITVNSICPAYV
RTPLVDKQIVDQARNHGISEDEVISKIMLSKAAVKRMIEPSELGEFVKFLCSDSAASISG
ACLTMDGGWTAA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaaaagtagctttaattacaggtgcagcaagtggtattggtttggcaatatgt
gagagccttgcaaccgaagatttaaatatagtgatggtggatgtaaataaagagacatta
aaagaacattccactcgtttaggaacggcttatattcaagcagatctttcgaaacgtgaa
ggttgtaaaactgcggtagattttgcagccgaaaaatttggtagcgtagatattttggta
aatgtagcaggtatccaaaatgtagccgccattgaaaatttttccgaagataaatgggat
tttatgattaacttaatgcttactgcaccatttttgcttactaaatacagttggaaatac
atgaaagcaaataaatggggacgtatcattaatttgaattcaatccacggtttagttgca
tctgatttcaaatctgcgtatgtttcagcaaaacacggtttatcgggcttaactaaagta
gctgcattggagggtggtgaatttggtattactgttaattctatctgtcctgcttatgtt
cgtacaccgttggttgataaacagatcgtagatcaagctcgtaatcatggaatttccgaa
gatgaagttattagcaaaatcatgctttctaaagctgctgttaaacgcatgattgaacct
tcagaactcggcgaatttgtcaaatttctctgttctgattcagcagcatcaatctctgga
gcttgcttaacaatggatggtggttggactgctgcctaa

DBGET integrated database retrieval system