KEGG   Haemophilus somnus 2336: HSM_0927Help
Entry
HSM_0927          CDS       T00673                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hsm  Haemophilus somnus 2336
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HSM_0927
  Amino acid metabolism
   00300 Lysine biosynthesis
    HSM_0927
Enzymes [BR:hsm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HSM_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1057267..1058400
Genome map
AA seq 377 aa AA seqDB search
MKNNIITLTQSLIQRPSISPDDQGCQQLIAERLQAVGFKLEWLPFGDTLNLWATHGEGKC
IAFAGHTDVVPIGNESQWTYPPFEARIVENMLYGRGAADMKGALAAMVIAAETFVKHLPN
HQGKIALLITSDEEAAATNGTVKVVETLIKRNEKIDYCVVGEPSSATQFGDIIKNGRRGS
ITGNLYIQGVQGHVAYPHLADNPVHNALKFLDELTHYQWDKGNEFFPPTSLQIANIHAGT
GSNNVIPGELYVQFNLRYCTEVTDEIIKTKVAEMLEKHKLTYRIDWNLSGKPFLTPQGKL
VNATIEAVKKFTQIRPHLDTGGGTSDARFIATMGAEVVEFGPLNQTIHKVNECVNIDDLA
KCGEIYYYILEKLFNEQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataacataattactctcactcaaagtcttattcaacgtccttcaattagccct
gatgatcaaggctgtcaacaacttattgccgaacgtttacaagctgttggttttaagttg
gagtggttaccttttggtgataccttaaatttatgggctactcatggtgaaggaaaatgt
attgcttttgcggggcatacagacgttgttccgattggtaatgaaagtcaatggacttat
ccgccttttgaagcccgaattgttgaaaatatgctgtatgggcgtggtgctgcggatatg
aaaggtgctttggcagcaatggttattgcggcggaaacttttgtgaaacacctgccaaat
catcagggaaaaatagccttgttgattacctctgatgaagaggcagcggctaccaatgga
acggtaaaagtagtggaaacgctaataaaacgtaacgaaaagattgactattgtgtagta
ggtgaaccttccagtgcaacgcaatttggcgacattattaaaaacggacgacgtggttct
attacaggaaatttgtatattcaaggtgtacaaggtcatgtggcttatcctcatttagcg
gataatcctgttcataatgccttgaaattcttagatgaattaactcattatcaatgggat
aaaggtaatgaatttttcccgccgaccagtttacaaatcgccaatattcatgcagggaca
ggtagtaataatgtaatccccggtgaactttatgtgcaatttaacttgcgttattgtact
gaggtgacagatgaaattattaaaactaaagtggctgagatgttggaaaagcataagtta
acgtaccgtatagactggaatttatcgggcaaaccgtttttaacacctcaaggaaaatta
gtaaatgctacaattgaagcagtgaaaaaatttactcaaatcagaccgcacttagataca
ggcggtgggacttccgatgctcgttttattgccacaatgggagcggaagtcgtggagttt
ggacctcttaatcaaaccattcataaagtgaatgaatgcgtgaatattgatgatttagcc
aagtgcggtgagatttattattatattttggaaaaattgtttaatgaacaatag

DBGET integrated database retrieval system