KEGG   Haemophilus somnus 2336: HSM_0936Help
Entry
HSM_0936          CDS       T00673                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
hsm  Haemophilus somnus 2336
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:hsm00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hsm00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1067268..1068587
Genome map
AA seq 439 aa AA seqDB search
MSNYFDKIAKVNYEGANSTNPFAFKHYNPNEVILGKTVEEHLRLAVCYWHTFCWTGNDMF
GAGSLDRSWQKTGDLLVGAKQKAEIAFEFFQKLGVPYYSFHDVDIAPESNNFKEYLHNFN
TIVDILEKKQSETGVKLLWGTANCFTNPRYMSGASTNPNPEVFAWAAAQVFTAMNATQRL
GGENYVLWGGREGYETLLNTDLKREREQIGRFMQLVVEHKYKIGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLENEIKVNIEANHATLAGHTFQHEIATATSLGIFGSIDANRG
DPQLGWDTDQFPNSVEENTLAMYEILKAGGFTTGGFNFDAKIRRQSTDPYDLFHAHIGAM
DVLALSLKRAAKMIEDQTLQKVVDNRYAGWDQELGQKILSGKASLEDLAKIVETQGLDPK
PVSGQQEYLENLVNSYLYR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtctaattattttgacaaaattgcaaaggtaaattacgaaggagcaaattccactaat
cctttcgcttttaaacactacaatccaaatgaagttattttaggtaaaacagtagaggaa
cacttgcgtctggcagtctgctattggcacacgttctgctggacaggtaacgatatgttc
ggtgccggttcattggatcgtagttggcaaaaaacaggtgatttgctggttggtgcaaaa
caaaaagcagaaattgcttttgaatttttccaaaaattaggtgtgccttattatagtttt
cacgatgtagatattgctcctgaaagcaataatttcaaagaatatttacataacttcaat
actattgtggatattttagagaaaaaacaatcagaaaccggtgtgaagttgttatgggga
acagcaaactgctttactaatcctcgttatatgtcaggggcttctaccaaccctaatccg
gaagtatttgcttgggcagcagcacaagtttttactgcaatgaatgcaactcaacgctta
gggggtgaaaactatgtattatggggcggacgagaagggtatgaaacattgctgaatacc
gatctcaaacgtgaacgtgaacaaattggccgttttatgcaattagtggtagaacataaa
tataaaatcggctttcaaggtacattactaattgaaccgaaaccacaagagccaactaaa
catcagtacgattatgatgttgcaacagtttatggttttttaaaacaattcggattagaa
aatgaaattaaagtgaatattgaagctaaccatgcaaccttggcagggcatacattccaa
catgaaattgcaacggcaacttcattaggcattttcggttctattgatgctaaccgtggc
gatccgcaattaggctgggataccgaccaattcccgaacagcgtggaagaaaatacgttg
gcaatgtatgaaatcttaaaagcgggtggtttcaccacaggcggtttcaactttgatgcg
aaaattcgtcgccaaagtaccgacccgtatgatttatttcatgcccatatcggtgcaatg
gatgtgttagctttgtcgctcaaacgtgctgcaaaaatgattgaagaccaaacgttgcaa
aaagtggtcgataaccgctatgctggttgggatcaagagctgggtcagaaaattctaagt
ggcaaagcgagcttggaggatcttgctaaaatagtagaaactcaagggttagatccaaaa
cctgtttcagggcagcaagaatatttagaaaatttagtgaatagctatctttatcgttaa

DBGET integrated database retrieval system