KEGG   Haemophilus somnus 2336: HSM_1013Help
Entry
HSM_1013          CDS       T00673                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hsm  Haemophilus somnus 2336
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HSM_1013
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HSM_1013
   00020 Citrate cycle (TCA cycle)
    HSM_1013
   00620 Pyruvate metabolism
    HSM_1013
Enzymes [BR:hsm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HSM_1013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1157227..1159113
Genome map
AA seq 628 aa AA seqDB search
MAKEIQIPDIGGDEVTVTEVMVKAGDTIIVDQSVINVEGDKASMEVPSPEAGVIKEVLVK
VGDKVSTGTPMFVLENAELASTETASESMQTEKTQSAVASIIEIYVPDIGGDEVNVTDIM
VSVGETVAEEQSILNVEGDKASMEVPAPTAGIVKEILIKVGDKVSTGSLVMKFEVAGVVS
VAETAQVSSSAQVTGESAVQDVHVPDIGGDEVNVTEIMVAVGDSVTEEQSLITVEGDKAS
MEVPAPFAGVVKEILVKSGDKVSTGSLIMRFEVQGKAPTPKASSAVTEAKVAPSPAAQEN
QMTPVSQADVTASAVFAHATPVVRRLAREFGVNLDKVKGTGRKGRILKEDVQAYVKAAIK
AVESGNVSPTSAGNGAVNGAGLGLLPWPKVDFSKFGDIEQVELGRIQKISGANLHRNWVM
IPHVTQWDKADITELEKFRKEQNVLAEKQKLDVKITPLVFIMKAVAKALENYPRFNSSLS
EDAQSLILKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELAEISKKARAGKLTASD
MQGGCFTISSLGGIGGTHFTPIVNAPEVAILGVSKSEMTPVWNGKDFTPRLMLPLSLSYD
HRVIDGADGARFITFINSVLSDLRRLVM
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaattcaaattccagatattggtggagatgaagttactgtcactgaagtt
atggttaaagctggggatactattatagttgatcaatctgtgattaacgttgaaggcgat
aaggcatcaatggaagttccatcaccggaagcgggtgtcattaaggaagtattagtaaaa
gtaggcgacaaagtttctactggaactcctatgtttgtattagagaatgcagaattagca
tctactgagacagcatctgaaagtatgcaaaccgaaaaaacacaaagtgcggtagcgtct
atcattgaaatttatgtacctgacattggtggtgatgaagtcaatgtaactgatattatg
gtttctgtaggtgagacagttgcagaagagcagtctattttaaatgttgagggtgataaa
gcctcaatggaagtgcctgcccctactgccggtatagtaaaagaaattttaatcaaagtg
ggagataaagtgtcgaccggttctcttgtgatgaaatttgaagttgcaggtgttgtatct
gtagccgaaacagctcaagtttcttcttcagctcaagtaacaggtgaaagtgcggtgcaa
gatgtacacgttcctgatatcggtggtgatgaagtcaatgtgacagaaattatggttgca
gtgggcgatagtgttacagaggaacaatctttaattactgttgaaggtgataaagcttca
atggaagtgcctgctccttttgctggtgtagtgaaagaaattttggtgaaatcaggggat
aaagtttcaactggttcattaattatgcgttttgaagtgcaaggaaaagcccctactcca
aaagcatcatcggctgtgacagaggctaaagtggctccatctccagctgcacaagaaaat
caaatgacgccagtgtctcaagctgatgtgactgcaagtgcggtgtttgctcatgcaact
ccggttgttcgtcgtctagctagagagttcggcgtgaacttagacaaggtaaaagggacg
gggcgtaaaggtcgaatcttaaaagaagacgttcaggcttatgtaaaagcggcaattaaa
gcggttgaaagtggcaatgtttctcctacatcagcaggtaatggtgctgtcaatggagca
ggactaggcttgttaccttggccgaaagtcgacttcagtaaatttggtgatattgagcaa
gttgagttgggtcgtattcagaaaatctccggtgcaaatttacatcgcaactgggtaatg
attcctcatgttacgcaatgggataaagcagacattacggaactggaaaaattccgcaaa
gaacaaaatgtgttggcggaaaaacaaaaacttgatgtaaaaattacgccattagtattt
attatgaaggccgttgctaaagcgttagaaaattacccacgctttaatagttcattatca
gaagatgctcaaagcctgattctgaaaaaatacattaatattggagtggcggttgataca
cctaacggcttggttgtacctgtgtttaaagatgtgaataaaaaaggcattattgaatta
tctcgtgaattagcggaaatttctaagaaggctcgagctggtaaattaaccgcatcagat
atgcaaggtggttgttttactatttcaagtctaggaggaattggcggtacacactttacg
ccaattgtaaatgctccagaagtcgcaattttgggtgtatctaaatctgaaatgacaccg
gtatggaatggcaaagactttactcctcgcttaatgcttccgttatctttgtcttatgat
catcgtgtaattgacggtgctgatggagcaagatttattactttcattaatagtgtatta
agcgatcttcgtcgtttagttatgtaa

DBGET integrated database retrieval system