KEGG   Haemophilus somnus 2336: HSM_1196Help
Entry
HSM_1196          CDS       T00673                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
hsm  Haemophilus somnus 2336
Pathway
hsm00790  Folate biosynthesis
hsm01100  Metabolic pathways
Module
hsm_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HSM_1196
Enzymes [BR:hsm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HSM_1196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ACA30918
JGI: HSM1196
UniProt: B0UTS1
Position
1352387..1353214
Genome map
AA seq 275 aa AA seqDB search
MKLQANNKTLDLSNPQIMGILNFTPDSFSDSGRFFSLDKALFQAERMLSEGASIIDIGGE
STRSNAAEVSLEQELDRVVPLVEAVRKRFDCWISVDTSKAEVMLESAKVGMDIINDIRAL
QEPNALETAVKLGLPTCIMHMQGQPRTMQQNPQYNNVVQEVLEFLQNHTALCLQAGMKKE
NIIWDPGLGFGKTVQQNYKLLQQVARFCQQDIPVLVGLSRKSMIGAVLDKPVGQRVIGSA
TGALLAAMNGAKILRVHDVDETLDALKIWQATEQA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacaagcaaataataaaactttagatctttcaaatcctcagattatggggatt
ttgaattttacgccggattctttttcagacagtggacgcttcttttctttagataaagcc
ttatttcaggcagaaagaatgttatcggaaggtgcgagtattattgatattggtggtgaa
tccactcgttctaatgcggcagaagtaagtttggagcaagaattggatcgtgttgtgcct
ttagttgaagctgtaagaaaacgttttgattgttggatttcagtagatacctctaaagct
gaagtaatgttggaaagtgctaaagtcggtatggatataatcaatgatattcgtgcatta
caagagcctaatgccttagagacagcggtaaaattagggttaccgacttgtattatgcat
atgcaagggcaacctcgtacaatgcaacaaaatccccaatataataatgtagtgcaggaa
gtattggaatttttacaaaatcacaccgcactttgtttacaagcgggcatgaaaaaagaa
aatattatttgggatcccggtttaggttttggtaaaactgtgcaacagaattataaatta
ttacagcaagttgcccgattttgtcagcaggatattcctgttttagtggggttatcacgt
aagtctatgattggtgcggtgttggataaacctgtaggccaaagagtaataggaagtgcg
acaggtgcattacttgcggcaatgaacggtgcaaaaattttgcgtgtacatgatgttgat
gaaacattagatgcattgaaaatttggcaagcaacagaacaggcttag

DBGET integrated database retrieval system