KEGG   Haemophilus somnus 2336: HSM_1197Help
Entry
HSM_1197          CDS       T00673                                 

Gene name
glmM
Definition
phosphoglucosamine mutase
Orthology
K03431  
phosphoglucosamine mutase [EC:5.4.2.10]
Organism
hsm  Haemophilus somnus 2336
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hsm00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1353305..1354639
Genome map
AA seq 444 aa AA seqDB search
MAERKYFGTDGVRGKVGSYPITPDFVLKLGWAAGKVLATQGTGKVLIGKDTRISGYMLES
ALEAGLAAAGLSAAFTGPMPTPAIAYLTRTFRSEAGIVISASHNPFYDNGIKFFSAQGTK
LPDDVEEAIEAMLEQPMDCVESAKLGRASRINDAAGRYIEFCKSTFPAHLSLDKYKIVVD
CANGATYHIAPNVMRELGAEVIEIGTQPDGMNINENCGATDIKALQNQVLETKADIGLAY
DGDGDRLIMVDHFGNKVDGDQILFIIAREALRSGNLKGGVVGTLMSNMSLELALKQLGIP
FVRANVGDRYVLEKMQEYNWILGGENSGHIIIADKNTTGDGVIASLAVLAAMVQHKLSLN
ELASAVKLFPQVLINVRFAGGANPLESDAVKAVATEVEKQLAGKGRILLRKSGTEPLIRV
MVECEDAELAQLSAEKIAEAVRSN
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgtaaatattttggaactgatggtgtgcgtggcaaagtaggaagttatcct
attactcccgattttgtgctgaaattaggatgggcagcaggtaaagtgctagctacacag
ggaactggtaaagtcctaattggtaaagatacacgtatttccggatatatgttggaatct
gcattagaagcggggttggcagctgcaggattatctgccgcatttaccggaccaatgcca
acaccggcaattgcttatttaacacgtacttttcgttcggaggcgggaattgttatttct
gcttcacataatcctttttatgacaatggaattaagtttttttctgcacaaggtacaaaa
ttacctgatgatgtggaagaagcaatagaggctatgttggaacagcctatggattgtgtt
gaatcagctaaattggggcgtgcaagccgtattaatgatgcggcaggtcgttatattgag
ttttgtaaaagtacttttccggcacatttaagtttagataagtataaaatcgtggtggac
tgtgcaaatggtgcaacttaccatattgcaccgaatgtcatgcgtgaacttggtgcagaa
gttattgaaattggtacgcaacccgatggtatgaatatcaatgaaaactgcggtgcaaca
gatatcaaagcattacaaaatcaagtattggaaacaaaagctgatatcggtttagcctat
gatggcgatggtgatcgcttaattatggttgatcattttggtaataaagttgatggcgat
cagatcttgtttattattgctcgtgaggcgttacgttcaggtaacttaaaaggtggcgtg
gtgggcacgttaatgagcaatatgagcttagagctcgctttaaagcaattgggaattcca
tttgttcgtgcaaatgtaggtgaccgctatgtgttagaaaaaatgcaagaatataattgg
attttgggtggtgaaaattcaggtcatattattattgcggataaaaatactaccggagac
ggtgtgatcgcttccttggcggtattagctgcaatggtgcaacataaattgtctttaaac
gaattagcaagtgcggtgaaattatttccacaagtgttaattaatgtacgttttgcaggt
ggtgcaaatccattggaaagtgatgcagtaaaagcagttgcaacagaggtcgaaaaacaa
cttgcaggcaagggcagaattttattacgcaaatccggaacggagccattaattagagtg
atggtggaatgtgaggatgctgaactggcacagctcagtgcagaaaaaattgctgaggca
gttagatctaattag

DBGET integrated database retrieval system