KEGG   Haemophilus somnus 2336: HSM_1216Help
Entry
HSM_1216          CDS       T00673                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hsm  Haemophilus somnus 2336
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HSM_1216
Enzymes [BR:hsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HSM_1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1373933..1374853
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLISYINDMPKMGETLEAHDFKMGCGGKGANQAIAAAKLGASVMMMTKV
GDDVFADNTINNFKQYGVNTDFVEKVVGVSSGVAPIFVDRSSQNRILIIKGANSYLKPAD
IDHAEVQLKNCKLLILQLEIPLETVYYAIDFANKHQIPVILNPAPASKELDISYACKCDF
FMPNETELEILTGMPVDNMEQIQAAANSLFLKGLKNLIVTLGEKGSVWFHRDQVTHVSSH
KVNAIDTSGAGDAFIGCFAHFYIQTNDVKQAMQMASAYSAYSVTGQGTQSSYPDKAQFEQ
FLQSLK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcagtcattggctcaaatatggtggatttaattagctatattaatgatatg
ccgaaaatgggtgaaacgctagaagctcatgattttaaaatgggttgtggcggaaaggga
gcaaatcaagctattgcagccgctaaattaggtgcatcagtaatgatgatgactaaggtt
ggtgatgatgtatttgcagataatactattaataatttcaagcaatatggtgtgaatacc
gattttgtcgaaaaagtggtgggtgtatcgagtggtgtagcccctatttttgttgatcgt
tcttcacaaaatcgcattttaattattaaaggtgcgaattcttacttgaaaccggcagat
attgatcatgctgaagttcagttgaaaaactgcaagctgcttattttacaactggaaatt
cctttagaaacagtttattacgcaattgattttgccaataaacatcaaattccagtcatt
cttaatcctgctcctgcaagtaaggaattagacattagttatgcttgtaaatgtgatttc
tttatgccgaatgaaactgaattggaaattctaaccggtatgccagttgacaatatggaa
cagattcaagcagcagctaatagcttatttttgaaaggattaaaaaatctgattgtgact
ttaggcgaaaaaggatcggtttggtttcatcgggatcaggtaacacatgtttcctcgcac
aaagttaatgctattgatactagtggtgctggagatgctttcattggttgttttgcacat
ttttatatacaaactaatgatgtcaaacaagcaatgcaaatggcatcagcctattcagcc
tatagtgtaaccggacaaggtacgcaatcttcttatccggataaagcacaattcgaacaa
tttctacaatcgttaaaataa

DBGET integrated database retrieval system