KEGG   Haemophilus somnus 2336: HSM_1242Help
Entry
HSM_1242          CDS       T00673                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hsm  Haemophilus somnus 2336
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HSM_1242
Enzymes [BR:hsm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HSM_1242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1400862..1401818
Genome map
AA seq 318 aa AA seqDB search
MSQHESHFNHFALAELYPFATQFPLQNIIGKKGIRIVYRHFVQEHCAERRLVILVNGRAE
NLLKWTELAYDFYRQGYDVLAFDHRGQGYSQRLLKDHDKGYIDEFRFYADDLTLLVEKIT
SLYHYRSQHILAHSLGTLISTYYLANDNHQIKSAVFSAPFYGIPLQHSLRDEFIINLMML
LGQGSRYVFGKGEYKPADLDKNDLSLCRTRMKWMNRINRRYPHIHLGGPTFRWVYECMYA
IKKLPVVLPRIEIPVLVLQSEREKIVDNQNLQKLTALLPQAQLVQIEHSRHEILFERDRI
RDLALAKINQFFTENNAK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacatgaatctcacttcaatcattttgccttagccgaactgtatccttttgct
acacaatttcctttgcaaaatataataggaaaaaaaggaatacgaatcgtctatcgccat
tttgttcaagaacattgtgctgaacgtagattagtgattttggtcaatggacgtgcagaa
aacttgttgaaatggacagagttggcttatgacttttatcgacaaggctatgatgtttta
gcgtttgatcatcgtggacaaggctattctcagcgtttattaaaagaccatgacaaaggc
tatattgatgagtttcgtttttatgcggatgatcttactttgttagtggaaaaaattact
tcgttgtatcactatcgtagccaacatattttggcacattctttaggcactttaatcagc
acttattatcttgccaatgataatcaccaaataaaaagtgcggtattttctgcaccattt
tatggtattccactgcagcattcattacgagatgaattcattattaatttaatgatgttg
cttgggcagggctcacgctatgtatttggcaaaggtgagtataaacccgctgatttagat
aagaatgatttgagtctttgtcgtactagaatgaaatggatgaatcgtattaatcgtcga
tacccacatattcatttaggcggaccaacttttcgttgggtatatgagtgtatgtatgcc
attaaaaaattacccgttgtcttaccccgaattgaaattccggtactagttttacaatca
gaaagagaaaaaattgtggataaccaaaatctgcaaaaattgaccgcacttttgcctcaa
gctcaactagtgcagattgaacatagtaggcatgagattttatttgaacgtgatcgaatt
cgagatttagcactagcaaaaatcaatcagttttttactgaaaataacgccaaataa

DBGET integrated database retrieval system