KEGG   Haemophilus somnus 2336: HSM_1388Help
Entry
HSM_1388          CDS       T00673                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hsm  Haemophilus somnus 2336
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hsm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1584629..1585285)
Genome map
AA seq 218 aa AA seqDB search
MSNLSPEAIKVRNALVEKGIETPMIDLVQDKDQRRQGIEQHMREVIKLIGLDLSDDSLEE
TPARLSKMFIDEIFSGLDYANFPKITNIENRMKVSEMVLVDDVTLTSTCEHHFVTIDGKV
SVAYYPQKWVIGLSKINRVVAFFAQRPQVQERLTQQILLAFQTILETEDVAVYVKATHFC
VKCRGIKDTNSYTVTSAFGGVFLDDRETRKEFLTLLKK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatttatctccggaagcgattaaggttcgtaatgctttggttgaaaaaggaatt
gaaacaccaatgattgatcttgtgcaagataaagatcaacgtcgtcaaggtattgaacaa
catatgcgtgaggttataaaactgattggtttagatttatctgatgacagtttggaagaa
acaccggcacgtttatcaaaaatgtttattgatgagatttttagtggtttagattacgct
aatttccctaaaattactaatattgaaaaccgcatgaaagtaagtgaaatggtgctagtt
gatgatgtgactttaaccagtacttgtgaacatcattttgtaactattgatggtaaagtg
tcagtagcttattacccgcaaaaatgggtgatcggtttatctaaaattaatcgtgttgtt
gctttttttgcacaacgtcctcaagttcaggaacgtctaacgcaacaaattttgttggca
ttccaaaccattttagaaacggaagatgtagccgtttatgttaaagctacgcatttttgc
gtaaaatgccgtggaattaaagataccaatagttacactgtgacatcggcttttggcgga
gtatttttggacgacagagaaaccagaaaagagtttttaaccttgttaaaaaaatga

DBGET integrated database retrieval system