KEGG   Haemophilus somnus 2336: HSM_1433Help
Entry
HSM_1433          CDS       T00673                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hsm  Haemophilus somnus 2336
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HSM_1433
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HSM_1433
  Amino acid metabolism
   00310 Lysine degradation
    HSM_1433
Enzymes [BR:hsm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HSM_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1637099..1638322)
Genome map
AA seq 407 aa AA seqDB search
MSNFDIITPDLPESVADATVVTWHKNVGDAVKCDEVLVEIETDKIVLEIPALSDGVLETI
LQPEGSTVVSKQLLGKVSASAGIGEVTKSTVQNVEKTPADRHSANLNTDASSDVLSPAVR
RLLAEHELNADEIKGTGVGGRITREDIALVVKQKAQQTETAQASQSIVTGLKIDHRNEKR
VPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMNLRKRYAEKFEKQHGARLGFMSFY
IKAVVEALKRYPEINASIDGDDIVYHNYFDISIAVSTPRGLVTPVVRNCDKLSMADIEKE
IKLLAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPVAV
NGEVVIRPMMYLALSYDHRLIDGRESVGFLVTVKDLLEDPTRLLLEI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatttcgatattattactccggatctccctgaatctgtggcggatgcaaccgtt
gtaacgtggcataagaacgtgggtgatgcggtaaaatgtgatgaagttttagtggaaatt
gaaactgataaaattgtgttggaaattcccgcacttagtgatggggtgcttgaaactatt
ttacaaccggaaggttcaactgtcgtgagtaaacaattgttgggtaaagtatccgcttcg
gcaggtattggagaagttacaaaatcaactgtacagaatgtggaaaaaacaccggcagat
cgtcattcggctaatttgaatactgatgcaagtagcgatgtactgagtccggctgttcgt
cgtttgttagcggagcatgaattaaatgctgatgaaattaaaggtacaggtgtaggtggt
cgaattactcgtgaagatatagcgttagtggttaagcaaaaagcacaacaaacagaaacg
gcacaagcatctcagtctattgtaactgggttgaaaattgatcatcgcaatgaaaaacgt
gtaccaatgacacgtttacgtaagcgtatcgcagagcgtttactggaagcaaaaaatact
actgcaatgctgacgacatttaatgaagtggatatgcagccgattatgaatttacgcaag
cgttatgcagaaaaatttgagaaacaacatggtgcacgcttaggatttatgtctttttat
atcaaagcggtggttgaagcactaaaacgctatccggagattaacgcatctattgatggt
gatgatattgtttaccacaattattttgatattagtattgctgtttccacacctcgtggt
ttggtaacgccggttgtacgtaattgcgataaattaagtatggcagatattgaaaaagaa
attaaattgttggcggaaaaaggtcgtgatggaaaattgaccgttgaagatttaacgggg
gggaattttactattactaacggtggcgtttttggttctttaatgtcaacacctattata
aatccgccacaaagtgcgattttgggtatgcatgcgattaaggatcgtcccgttgcggtt
aatggtgaagtggttattcgcccaatgatgtatttggcactaagctatgatcaccgttta
atcgatggacgtgaaagcgtcggtttcttggtgacagtgaaggacttgctggaagatccg
actcgcttgctactggaaatttag

DBGET integrated database retrieval system