KEGG   Haemophilus somnus 2336: HSM_1433Help
Entry
HSM_1433          CDS       T00673                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hsm  Haemophilus somnus 2336
Pathway
hsm00020  Citrate cycle (TCA cycle)
hsm00310  Lysine degradation
hsm01100  Metabolic pathways
hsm01110  Biosynthesis of secondary metabolites
hsm01120  Microbial metabolism in diverse environments
hsm01130  Biosynthesis of antibiotics
hsm01200  Carbon metabolism
Module
hsm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HSM_1433
  Amino acid metabolism
   00310 Lysine degradation
    HSM_1433
Enzymes [BR:hsm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HSM_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ACA31178
JGI: HSM1433
UniProt: B0UUF4
Position
complement(1637099..1638322)
Genome map
AA seq 407 aa AA seqDB search
MSNFDIITPDLPESVADATVVTWHKNVGDAVKCDEVLVEIETDKIVLEIPALSDGVLETI
LQPEGSTVVSKQLLGKVSASAGIGEVTKSTVQNVEKTPADRHSANLNTDASSDVLSPAVR
RLLAEHELNADEIKGTGVGGRITREDIALVVKQKAQQTETAQASQSIVTGLKIDHRNEKR
VPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMNLRKRYAEKFEKQHGARLGFMSFY
IKAVVEALKRYPEINASIDGDDIVYHNYFDISIAVSTPRGLVTPVVRNCDKLSMADIEKE
IKLLAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPVAV
NGEVVIRPMMYLALSYDHRLIDGRESVGFLVTVKDLLEDPTRLLLEI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatttcgatattattactccggatctccctgaatctgtggcggatgcaaccgtt
gtaacgtggcataagaacgtgggtgatgcggtaaaatgtgatgaagttttagtggaaatt
gaaactgataaaattgtgttggaaattcccgcacttagtgatggggtgcttgaaactatt
ttacaaccggaaggttcaactgtcgtgagtaaacaattgttgggtaaagtatccgcttcg
gcaggtattggagaagttacaaaatcaactgtacagaatgtggaaaaaacaccggcagat
cgtcattcggctaatttgaatactgatgcaagtagcgatgtactgagtccggctgttcgt
cgtttgttagcggagcatgaattaaatgctgatgaaattaaaggtacaggtgtaggtggt
cgaattactcgtgaagatatagcgttagtggttaagcaaaaagcacaacaaacagaaacg
gcacaagcatctcagtctattgtaactgggttgaaaattgatcatcgcaatgaaaaacgt
gtaccaatgacacgtttacgtaagcgtatcgcagagcgtttactggaagcaaaaaatact
actgcaatgctgacgacatttaatgaagtggatatgcagccgattatgaatttacgcaag
cgttatgcagaaaaatttgagaaacaacatggtgcacgcttaggatttatgtctttttat
atcaaagcggtggttgaagcactaaaacgctatccggagattaacgcatctattgatggt
gatgatattgtttaccacaattattttgatattagtattgctgtttccacacctcgtggt
ttggtaacgccggttgtacgtaattgcgataaattaagtatggcagatattgaaaaagaa
attaaattgttggcggaaaaaggtcgtgatggaaaattgaccgttgaagatttaacgggg
gggaattttactattactaacggtggcgtttttggttctttaatgtcaacacctattata
aatccgccacaaagtgcgattttgggtatgcatgcgattaaggatcgtcccgttgcggtt
aatggtgaagtggttattcgcccaatgatgtatttggcactaagctatgatcaccgttta
atcgatggacgtgaaagcgtcggtttcttggtgacagtgaaggacttgctggaagatccg
actcgcttgctactggaaatttag

DBGET integrated database retrieval system