KEGG   Haemophilus somnus 2336: HSM_1433Help
Entry
HSM_1433          CDS       T00673                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hsm  Haemophilus somnus 2336
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HSM_1433
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HSM_1433
  Amino acid metabolism
   00310 Lysine degradation
    HSM_1433
Enzymes [BR:hsm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HSM_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1637099..1638322)
Genome map
AA seq 407 aa AA seqDB search
MSNFDIITPDLPESVADATVVTWHKNVGDAVKCDEVLVEIETDKIVLEIPALSDGVLETI
LQPEGSTVVSKQLLGKVSASAGIGEVTKSTVQNVEKTPADRHSANLNTDASSDVLSPAVR
RLLAEHELNADEIKGTGVGGRITREDIALVVKQKAQQTETAQASQSIVTGLKIDHRNEKR
VPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMNLRKRYAEKFEKQHGARLGFMSFY
IKAVVEALKRYPEINASIDGDDIVYHNYFDISIAVSTPRGLVTPVVRNCDKLSMADIEKE
IKLLAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPVAV
NGEVVIRPMMYLALSYDHRLIDGRESVGFLVTVKDLLEDPTRLLLEI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatttcgatattattactccggatctccctgaatctgtggcggatgcaaccgtt
gtaacgtggcataagaacgtgggtgatgcggtaaaatgtgatgaagttttagtggaaatt
gaaactgataaaattgtgttggaaattcccgcacttagtgatggggtgcttgaaactatt
ttacaaccggaaggttcaactgtcgtgagtaaacaattgttgggtaaagtatccgcttcg
gcaggtattggagaagttacaaaatcaactgtacagaatgtggaaaaaacaccggcagat
cgtcattcggctaatttgaatactgatgcaagtagcgatgtactgagtccggctgttcgt
cgtttgttagcggagcatgaattaaatgctgatgaaattaaaggtacaggtgtaggtggt
cgaattactcgtgaagatatagcgttagtggttaagcaaaaagcacaacaaacagaaacg
gcacaagcatctcagtctattgtaactgggttgaaaattgatcatcgcaatgaaaaacgt
gtaccaatgacacgtttacgtaagcgtatcgcagagcgtttactggaagcaaaaaatact
actgcaatgctgacgacatttaatgaagtggatatgcagccgattatgaatttacgcaag
cgttatgcagaaaaatttgagaaacaacatggtgcacgcttaggatttatgtctttttat
atcaaagcggtggttgaagcactaaaacgctatccggagattaacgcatctattgatggt
gatgatattgtttaccacaattattttgatattagtattgctgtttccacacctcgtggt
ttggtaacgccggttgtacgtaattgcgataaattaagtatggcagatattgaaaaagaa
attaaattgttggcggaaaaaggtcgtgatggaaaattgaccgttgaagatttaacgggg
gggaattttactattactaacggtggcgtttttggttctttaatgtcaacacctattata
aatccgccacaaagtgcgattttgggtatgcatgcgattaaggatcgtcccgttgcggtt
aatggtgaagtggttattcgcccaatgatgtatttggcactaagctatgatcaccgttta
atcgatggacgtgaaagcgtcggtttcttggtgacagtgaaggacttgctggaagatccg
actcgcttgctactggaaatttag

DBGET integrated database retrieval system