KEGG   Haemophilus somnus 2336: HSM_1503Help
Entry
HSM_1503          CDS       T00673                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hsm  Haemophilus somnus 2336
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HSM_1503
Enzymes [BR:hsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HSM_1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1730895..1731371
Genome map
AA seq 158 aa AA seqDB search
MKTVYIALGSNLDTPIQQLNLALGSLAQLKSCKLSAVSSFYQSKPLGPQDQPDYVNAVAC
LKTELDPIALLDQLQHIENQQGRVRLRRWGERTLDLDILLYGNEIIQNERLTIPHYDMKN
REFVIIPLYEIAPHLILPHGEKLADIMLNFTHHQMQKL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgtttatatcgctttaggaagtaaccttgatacgcctatacaacaactaaat
ctggcactaggttcattagctcaactcaaaagttgtaaattaagtgcggtaagttctttt
tatcaaagtaaacctcttggtccacaagatcaaccggattacgtgaatgcggttgcttgt
ttaaaaaccgaattagatcccatagccctattggatcaattacaacatatagaaaaccaa
caaggacgagtgcggttacgtcgttggggtgaacgtactttagatttagatattttgtta
tatggcaatgaaattatccaaaatgaacgcttaacaattcctcattacgatatgaaaaat
cgtgaatttgttatcattcctctttatgaaattgcaccacatctcattttacctcatggc
gaaaaattagcggatataatgctcaatttcactcatcatcaaatgcaaaaattataa

DBGET integrated database retrieval system