KEGG   Haemophilus somnus 2336: HSM_1661Help
Entry
HSM_1661          CDS       T00673                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hsm  Haemophilus somnus 2336
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hsm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HSM_1661
Enzymes [BR:hsm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HSM_1661
Exosome [BR:hsm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HSM_1661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1908571..1909593
Genome map
AA seq 340 aa AA seqDB search
MTKQIFTGYPQRRLRRMRKQDFSRRLMSENKLTVDDLIYPVFIIEGENHRESVPSMPNVE
RLTLDQLLLEAELMVKYGVPVIALFPVIEQEKKSLMAEEAYNQDGLVQRAVKALKANFPE
LGVLTDVALDPYTVHGQDGIIDEYGYVLNDVTSDVLIKQALSHAQAGADIVAPSDMMDGR
IGRIRTALEKQGFVNTLIMAYSAKYASNYYGPFRDAVGSASNLKGGDKKTYQLDPANSNE
GLQEVALDIEEGADMVMVKPGMPYLDMVYRVKDQFGVPTFAYQVSGEYAMHMAAIQNGWL
KEKECIMESLLCFKRAGADGILTYFAKQVAEWLYLDEKNK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacaaatatttaccggatatcctcaacgccgtttacgtcgtatgcgtaagcag
gattttagtcgtcgtttgatgtcggaaaataagctgacagtagatgacttgatttatcct
gtgtttattattgagggagaaaatcatcgtgagtcggtgccttctatgcccaatgtggag
aggttaacgctcgatcaacttttacttgaagcggaattgatggtgaaatacggtgtgcct
gttattgcattgtttcctgtcattgaacaagagaaaaaatccttaatggcggaagaggct
tataatcaagacggcttagttcaacgagcggtaaaagcattaaaagcaaatttccctgaa
ttaggtgtactgactgatgtggctttagatccttatactgttcatggacaagatgggatt
attgatgaatatggatatgtactcaatgatgtaacttctgatgtacttataaaacaagcc
ctttctcatgctcaagcaggggcggatattgttgcccctagcgatatgatggacggtaga
attggtagaattcgtaccgcacttgaaaagcaaggctttgttaatacactcattatggct
tattctgctaagtatgcctcaaattattacggaccatttcgtgatgctgtcggatctgca
tcaaacttaaaagggggcgacaaaaaaacctatcaactggatcctgctaattctaatgag
ggattacaagaggttgctcttgatattgaagaaggtgcggatatggttatggttaaaccg
ggtatgccctatttggatatggtttatcgagttaaagatcaattcggcgtgccgactttt
gcttatcaagtatctggcgaatacgctatgcacatggcagctattcaaaatggttggcta
aaagaaaaagaatgtattatggagagtttactttgctttaaacgagcaggtgcggacgga
attttaacttattttgctaaacaggtagcggaatggttgtatttagacgaaaagaataaa
taa

DBGET integrated database retrieval system